BLASTX nr result
ID: Paeonia22_contig00021446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00021446 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprot... 55 1e-10 dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polypro... 55 1e-10 ref|XP_007207232.1| hypothetical protein PRUPE_ppa026856mg [Prun... 49 4e-08 ref|XP_007212569.1| hypothetical protein PRUPE_ppa015570mg, part... 50 5e-08 ref|XP_004295592.1| PREDICTED: uncharacterized protein LOC101291... 51 6e-08 gb|EXC16208.1| hypothetical protein L484_024379 [Morus notabilis] 45 6e-08 ref|XP_007220384.1| hypothetical protein PRUPE_ppa021778mg [Prun... 49 7e-08 ref|XP_007210190.1| hypothetical protein PRUPE_ppa017790mg [Prun... 47 2e-07 ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, part... 47 2e-07 ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, part... 47 2e-07 ref|XP_007226836.1| hypothetical protein PRUPE_ppa017565mg, part... 49 2e-07 ref|XP_007220740.1| hypothetical protein PRUPE_ppa023598mg [Prun... 47 5e-07 ref|XP_007010495.1| Uncharacterized protein TCM_044370 [Theobrom... 54 1e-06 ref|XP_007019612.1| Uncharacterized protein TCM_035725 [Theobrom... 52 3e-06 ref|XP_004154771.1| PREDICTED: kanadaptin-like [Cucumis sativus] 50 4e-06 ref|XP_007023626.1| Uncharacterized protein TCM_046829 [Theobrom... 52 6e-06 ref|XP_007212978.1| hypothetical protein PRUPE_ppa022475mg [Prun... 49 6e-06 ref|XP_007049889.1| Uncharacterized protein TCM_003129 [Theobrom... 52 6e-06 ref|XP_007051412.1| DNA/RNA polymerases superfamily protein [The... 52 8e-06 ref|XP_007019474.1| Uncharacterized protein TCM_035549 [Theobrom... 52 8e-06 >gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 280 Score = 54.7 bits (130), Expect(2) = 1e-10 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR FKEGD VMV L +GRF TYNK+K RKY PFK+ KI Sbjct: 184 RRFKVFKEGDDVMVLLRKGRFAVGTYNKVKPRKYGPFKVLRKI 226 Score = 37.0 bits (84), Expect(2) = 1e-10 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY +ALP S NI+NTFN+ D Sbjct: 226 INDNAYVVALPKSMNISNTFNVAD 249 >dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 127 Score = 54.7 bits (130), Expect(2) = 1e-10 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR FKEGD VMV L +GRF TYNK+K RKY PFK+ KI Sbjct: 31 RRFKVFKEGDDVMVLLRKGRFAVGTYNKVKPRKYGPFKVLRKI 73 Score = 37.0 bits (84), Expect(2) = 1e-10 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY +ALP S NI+NTFN+ D Sbjct: 73 INDNAYVVALPKSMNISNTFNVAD 96 >ref|XP_007207232.1| hypothetical protein PRUPE_ppa026856mg [Prunus persica] gi|462402874|gb|EMJ08431.1| hypothetical protein PRUPE_ppa026856mg [Prunus persica] Length = 1493 Score = 48.9 bits (115), Expect(2) = 4e-08 Identities = 23/43 (53%), Positives = 31/43 (72%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VMV+L + RF A TY+KLK +KY P+K+ +I Sbjct: 1387 RRVKVFQEGDSVMVFLRKERFPAGTYSKLKPKKYGPYKVLKRI 1429 Score = 33.9 bits (76), Expect(2) = 4e-08 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I+N FN+ D Sbjct: 1429 INDNAYDIELPDSMGISNIFNVAD 1452 >ref|XP_007212569.1| hypothetical protein PRUPE_ppa015570mg, partial [Prunus persica] gi|462408434|gb|EMJ13768.1| hypothetical protein PRUPE_ppa015570mg, partial [Prunus persica] Length = 541 Score = 50.1 bits (118), Expect(2) = 5e-08 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VM++L + RF DTY+KLK +KY P+K+ +I Sbjct: 468 RRVKVFREGDSVMIFLRKERFPVDTYSKLKPKKYGPYKVLKRI 510 Score = 32.7 bits (73), Expect(2) = 5e-08 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I N FN+ D Sbjct: 510 INDNAYVIELPDSMGIPNIFNVAD 533 >ref|XP_004295592.1| PREDICTED: uncharacterized protein LOC101291324 [Fragaria vesca subsp. vesca] Length = 2122 Score = 50.8 bits (120), Expect(2) = 6e-08 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR FKEGD VMV+L + RF TYNKL+ +KY PFK+ KI Sbjct: 1380 RRIKLFKEGDDVMVFLRKERFPVGTYNKLQPKKYGPFKVLRKI 1422 Score = 31.6 bits (70), Expect(2) = 6e-08 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY +ALP +I+NTFN+ D Sbjct: 1422 INDNAYVVALPAFISISNTFNVAD 1445 >gb|EXC16208.1| hypothetical protein L484_024379 [Morus notabilis] Length = 402 Score = 45.4 bits (106), Expect(2) = 6e-08 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTY-NKLKSRKYRPFKIAHKI 129 RRK F GDLVMV++ + R L D + KL+ R+Y PF I+HK+ Sbjct: 309 RRKKTFDVGDLVMVHIRKERLLTDPHLGKLQPRRYGPFHISHKV 352 Score = 37.0 bits (84), Expect(2) = 6e-08 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 + DNAY + LPD W I++TFN+ D Sbjct: 352 VSDNAYVVGLPDDWEISSTFNVAD 375 >ref|XP_007220384.1| hypothetical protein PRUPE_ppa021778mg [Prunus persica] gi|462416846|gb|EMJ21583.1| hypothetical protein PRUPE_ppa021778mg [Prunus persica] Length = 1384 Score = 48.5 bits (114), Expect(2) = 7e-08 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VM++L + RF A TY+KLK +KY P+K+ +I Sbjct: 1278 RRVKVFQEGDSVMIFLRKERFPAGTYSKLKPKKYGPYKVLKRI 1320 Score = 33.5 bits (75), Expect(2) = 7e-08 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I+N FN+ D Sbjct: 1320 INDNAYVIELPDSMGISNIFNVAD 1343 >ref|XP_007210190.1| hypothetical protein PRUPE_ppa017790mg [Prunus persica] gi|462405925|gb|EMJ11389.1| hypothetical protein PRUPE_ppa017790mg [Prunus persica] Length = 1485 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VM++L + RF TY+KLK +KY P+K+ +I Sbjct: 1379 RRVKVFQEGDSVMIFLRKERFPVGTYSKLKPKKYGPYKVLKRI 1421 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I+N FN+ D Sbjct: 1421 INDNAYVIELPDSMGISNIFNVAD 1444 >ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] gi|462412311|gb|EMJ17360.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] Length = 1150 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VM++L + RF TY+KLK +KY P+K+ +I Sbjct: 1077 RRVKVFQEGDSVMIFLRKERFPVGTYSKLKPKKYGPYKVLKRI 1119 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I+N FN+ D Sbjct: 1119 INDNAYVIELPDSMGISNIFNVAD 1142 >ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] gi|462395598|gb|EMJ01397.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] Length = 1057 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VM++L + RF TY+KLK +KY P+K+ +I Sbjct: 945 RRVKVFQEGDSVMIFLRKERFPVGTYSKLKPKKYGPYKVLKRI 987 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I+N FN+ D Sbjct: 987 INDNAYVIELPDSMGISNIFNVAD 1010 >ref|XP_007226836.1| hypothetical protein PRUPE_ppa017565mg, partial [Prunus persica] gi|462423772|gb|EMJ28035.1| hypothetical protein PRUPE_ppa017565mg, partial [Prunus persica] Length = 914 Score = 49.3 bits (116), Expect(2) = 2e-07 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VMV+L RF A TY+KLK +KY P+K+ +I Sbjct: 849 RRVRVFQEGDFVMVFLRMERFRAGTYSKLKPKKYGPYKVLKRI 891 Score = 31.2 bits (69), Expect(2) = 2e-07 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNA+ I LP+S I+NTFN+ D Sbjct: 891 INDNAHVIELPNSVGISNTFNVAD 914 >ref|XP_007220740.1| hypothetical protein PRUPE_ppa023598mg [Prunus persica] gi|462417202|gb|EMJ21939.1| hypothetical protein PRUPE_ppa023598mg [Prunus persica] Length = 1457 Score = 47.0 bits (110), Expect(2) = 5e-07 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR F+EGD VM++L + RF TY+KLK +KY P+K+ +I Sbjct: 1337 RRVKVFQEGDSVMIFLRKERFPVGTYSKLKPKKYGPYKVLKRI 1379 Score = 32.3 bits (72), Expect(2) = 5e-07 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I DNAY I LPDS I N FN+ D Sbjct: 1379 INDNAYVIELPDSMGIFNIFNVAD 1402 >ref|XP_007010495.1| Uncharacterized protein TCM_044370 [Theobroma cacao] gi|508727408|gb|EOY19305.1| Uncharacterized protein TCM_044370 [Theobroma cacao] Length = 1306 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRS 135 RRK F+EGD V+VYL + RF TY+KLKSRK+ P K+ KI S Sbjct: 1192 RRKQEFEEGDQVLVYLRQERFPKGTYHKLKSRKFGPCKVLKKISS 1236 Score = 24.3 bits (51), Expect(2) = 1e-06 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I NAY I LP I++ FN+ D Sbjct: 1234 ISSNAYLIELPPELQISHIFNVLD 1257 >ref|XP_007019612.1| Uncharacterized protein TCM_035725 [Theobroma cacao] gi|508724940|gb|EOY16837.1| Uncharacterized protein TCM_035725 [Theobroma cacao] Length = 499 Score = 52.0 bits (123), Expect(2) = 3e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRS 135 RRK F+EGD V+V+L + RF TY+KLKSRK+ P K+ KI S Sbjct: 343 RRKQEFEEGDQVLVHLRQERFPKGTYHKLKSRKFGPCKVLKKISS 387 Score = 24.6 bits (52), Expect(2) = 3e-06 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I NAY I LP I++ FNI D Sbjct: 385 ISSNAYLIELPPELQISHIFNILD 408 >ref|XP_004154771.1| PREDICTED: kanadaptin-like [Cucumis sativus] Length = 962 Score = 49.7 bits (117), Expect(2) = 4e-06 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKI 129 RR+ F EGDLVM++L + RF TYNKLK R+ PF++ KI Sbjct: 337 RRQATFTEGDLVMIHLRKIRFPTGTYNKLKDRQLGPFRVLEKI 379 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 138 DNAYKIALPDSWNITNTFNIED 203 DNAY+I LP N+ FN+ D Sbjct: 381 DNAYRIELPLDLNVHPIFNVAD 402 >ref|XP_007023626.1| Uncharacterized protein TCM_046829 [Theobroma cacao] gi|508778992|gb|EOY26248.1| Uncharacterized protein TCM_046829 [Theobroma cacao] Length = 672 Score = 52.0 bits (123), Expect(2) = 6e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRS 135 RRK F+EGD V+V+L + RF TY+KLKSRK+ P K+ KI S Sbjct: 516 RRKQEFEEGDQVLVHLRQERFPKGTYHKLKSRKFGPCKVLKKISS 560 Score = 23.5 bits (49), Expect(2) = 6e-06 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I NAY I LP I+ FNI D Sbjct: 558 ISSNAYLIELPPELQISPIFNILD 581 >ref|XP_007212978.1| hypothetical protein PRUPE_ppa022475mg [Prunus persica] gi|462408843|gb|EMJ14177.1| hypothetical protein PRUPE_ppa022475mg [Prunus persica] Length = 515 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +1 Query: 16 FKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRSLT 141 F EG+ VMVYL + RF TY+KL++RKY P+KI KI T Sbjct: 425 FNEGNSVMVYLKKERFSVGTYHKLQARKYGPYKILKKINDNT 466 Score = 26.9 bits (58), Expect(2) = 6e-06 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNI 197 I DN Y + LP S I++TFN+ Sbjct: 462 INDNTYIVDLPSSMEISSTFNV 483 >ref|XP_007049889.1| Uncharacterized protein TCM_003129 [Theobroma cacao] gi|508702150|gb|EOX94046.1| Uncharacterized protein TCM_003129 [Theobroma cacao] Length = 253 Score = 52.0 bits (123), Expect(2) = 6e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRS 135 RRK F+EGD V+V+L + RF TY+KLKSRK+ P K+ KI S Sbjct: 97 RRKQEFEEGDQVLVHLRQERFPKGTYHKLKSRKFGPCKVLKKISS 141 Score = 23.5 bits (49), Expect(2) = 6e-06 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I NAY I LP I+ FNI D Sbjct: 139 ISSNAYLIELPPELQISPIFNILD 162 >ref|XP_007051412.1| DNA/RNA polymerases superfamily protein [Theobroma cacao] gi|508703673|gb|EOX95569.1| DNA/RNA polymerases superfamily protein [Theobroma cacao] Length = 1452 Score = 52.0 bits (123), Expect(2) = 8e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRS 135 RRK F+EGD V+V+L + RF TY+KLKSRK+ P K+ KI S Sbjct: 1296 RRKQEFEEGDQVLVHLRQERFPKGTYHKLKSRKFGPCKVLKKISS 1340 Score = 23.1 bits (48), Expect(2) = 8e-06 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I NAY I LP I FNI D Sbjct: 1338 ISSNAYLIELPPELQINPIFNILD 1361 >ref|XP_007019474.1| Uncharacterized protein TCM_035549 [Theobroma cacao] gi|508724802|gb|EOY16699.1| Uncharacterized protein TCM_035549 [Theobroma cacao] Length = 1392 Score = 52.0 bits (123), Expect(2) = 8e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 1 RRKHNFKEGDLVMVYLSEGRFLADTYNKLKSRKYRPFKIAHKIRS 135 RRK F+EGD V+V+L + RF TY+KLKSRK+ P K+ KI S Sbjct: 1236 RRKQEFEEGDQVLVHLRQERFPKGTYHKLKSRKFGPCKVLKKISS 1280 Score = 23.1 bits (48), Expect(2) = 8e-06 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 132 IIDNAYKIALPDSWNITNTFNIED 203 I NAY I LP I+ FN+ D Sbjct: 1278 ISSNAYLIELPPELQISPIFNVLD 1301