BLASTX nr result
ID: Paeonia22_contig00021402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00021402 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006416367.1| hypothetical protein EUTSA_v10006674mg [Eutr... 57 3e-06 ref|NP_173499.1| calcium-binding EF hand-containing protein [Ara... 57 3e-06 ref|XP_002890407.1| calcium-binding EF hand family protein [Arab... 57 3e-06 dbj|BAE99450.1| hypothetical protein [Arabidopsis thaliana] 57 3e-06 ref|XP_006306658.1| hypothetical protein CARUB_v10008174mg [Caps... 57 3e-06 >ref|XP_006416367.1| hypothetical protein EUTSA_v10006674mg [Eutrema salsugineum] gi|557094138|gb|ESQ34720.1| hypothetical protein EUTSA_v10006674mg [Eutrema salsugineum] Length = 1006 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 242 MANQGANMDQFDLYFRRADLDGDGRISGAEAV 337 MA Q NMDQF+ YF+RADLDGDGRISGAEAV Sbjct: 1 MAGQNPNMDQFEAYFKRADLDGDGRISGAEAV 32 >ref|NP_173499.1| calcium-binding EF hand-containing protein [Arabidopsis thaliana] gi|8886934|gb|AAF80620.1|AC069251_13 F2D10.25 [Arabidopsis thaliana] gi|110742187|dbj|BAE99021.1| hypothetical protein [Arabidopsis thaliana] gi|332191898|gb|AEE30019.1| calcium-binding EF hand-containing protein [Arabidopsis thaliana] Length = 1019 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 242 MANQGANMDQFDLYFRRADLDGDGRISGAEAV 337 MA Q NMDQF+ YF+RADLDGDGRISGAEAV Sbjct: 1 MAGQNPNMDQFEAYFKRADLDGDGRISGAEAV 32 >ref|XP_002890407.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297336249|gb|EFH66666.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 242 MANQGANMDQFDLYFRRADLDGDGRISGAEAV 337 MA Q NMDQF+ YF+RADLDGDGRISGAEAV Sbjct: 1 MAGQNPNMDQFEAYFKRADLDGDGRISGAEAV 32 >dbj|BAE99450.1| hypothetical protein [Arabidopsis thaliana] Length = 572 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 242 MANQGANMDQFDLYFRRADLDGDGRISGAEAV 337 MA Q NMDQF+ YF+RADLDGDGRISGAEAV Sbjct: 1 MAGQNPNMDQFEAYFKRADLDGDGRISGAEAV 32 >ref|XP_006306658.1| hypothetical protein CARUB_v10008174mg [Capsella rubella] gi|482575369|gb|EOA39556.1| hypothetical protein CARUB_v10008174mg [Capsella rubella] Length = 1025 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 242 MANQGANMDQFDLYFRRADLDGDGRISGAEAV 337 MA Q NMDQF+ +FRRADLDGDGRISGAEAV Sbjct: 1 MAGQNPNMDQFEAFFRRADLDGDGRISGAEAV 32