BLASTX nr result
ID: Paeonia22_contig00021159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00021159 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_188924.3| transmembrane emp24 domain-containing protein p... 54 6e-08 ref|XP_006406122.1| hypothetical protein EUTSA_v10021495mg [Eutr... 53 8e-08 ref|XP_002883380.1| hypothetical protein ARALYDRAFT_479795 [Arab... 53 8e-08 ref|XP_006299601.1| hypothetical protein CARUB_v10015779mg [Caps... 52 2e-07 ref|XP_004496668.1| PREDICTED: transmembrane emp24 domain-contai... 49 1e-06 ref|XP_006363461.1| PREDICTED: transmembrane emp24 domain-contai... 49 1e-06 ref|XP_004247610.1| PREDICTED: transmembrane emp24 domain-contai... 49 1e-06 ref|XP_006443971.1| hypothetical protein CICLE_v10024247mg [Citr... 49 3e-06 ref|XP_007200451.1| hypothetical protein PRUPE_ppa011262mg [Prun... 47 4e-06 >ref|NP_188924.3| transmembrane emp24 domain-containing protein p24beta3 [Arabidopsis thaliana] gi|75273406|sp|Q9LIL4.1|P24B3_ARATH RecName: Full=Transmembrane emp24 domain-containing protein p24beta3; AltName: Full=p24 family protein beta2; Short=p24beta2; AltName: Full=p24 family protein beta3; Short=p24beta3; Flags: Precursor gi|11994713|dbj|BAB03029.1| coated vesicle membrane protein-like [Arabidopsis thaliana] gi|17979492|gb|AAL50082.1| AT3g22845/MWI23_22 [Arabidopsis thaliana] gi|20147305|gb|AAM10366.1| AT3g22845/MWI23_22 [Arabidopsis thaliana] gi|332643162|gb|AEE76683.1| transmembrane emp24 domain-containing protein p24beta3 [Arabidopsis thaliana] Length = 214 Score = 53.5 bits (127), Expect(2) = 6e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 LKGTS D FEFKAP S MY+FCF+NPYST Sbjct: 84 LKGTSGDKFEFKAPKSGMYKFCFHNPYST 112 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIHVGHIP Sbjct: 114 ETVSFYIHVGHIP 126 >ref|XP_006406122.1| hypothetical protein EUTSA_v10021495mg [Eutrema salsugineum] gi|557107268|gb|ESQ47575.1| hypothetical protein EUTSA_v10021495mg [Eutrema salsugineum] Length = 217 Score = 53.1 bits (126), Expect(2) = 8e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 LKGTS D FEFKAP S MY+FCF+NPYST Sbjct: 87 LKGTSGDKFEFKAPRSGMYKFCFHNPYST 115 Score = 28.9 bits (63), Expect(2) = 8e-08 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIHVGHIP Sbjct: 117 ETVSFYIHVGHIP 129 >ref|XP_002883380.1| hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. lyrata] gi|297329220|gb|EFH59639.1| hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. lyrata] Length = 214 Score = 53.1 bits (126), Expect(2) = 8e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 LKGTS D FEFKAP S MY+FCF+NPYST Sbjct: 84 LKGTSGDKFEFKAPRSGMYKFCFHNPYST 112 Score = 28.9 bits (63), Expect(2) = 8e-08 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIHVGHIP Sbjct: 114 ETVSFYIHVGHIP 126 >ref|XP_006299601.1| hypothetical protein CARUB_v10015779mg [Capsella rubella] gi|482568310|gb|EOA32499.1| hypothetical protein CARUB_v10015779mg [Capsella rubella] Length = 214 Score = 52.0 bits (123), Expect(2) = 2e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 +KGTS D FEFKAP S MY+FCF+NPYST Sbjct: 84 VKGTSGDKFEFKAPRSGMYKFCFHNPYST 112 Score = 28.9 bits (63), Expect(2) = 2e-07 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIHVGHIP Sbjct: 114 ETVSFYIHVGHIP 126 >ref|XP_004496668.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like [Cicer arietinum] Length = 216 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 +KGTS D F+FKAP MY+FCF+NPYST Sbjct: 86 IKGTSGDKFQFKAPVHGMYKFCFHNPYST 114 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIHVGHIP Sbjct: 116 ETVSFYIHVGHIP 128 >ref|XP_006363461.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like [Solanum tuberosum] Length = 218 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 94 EEIQYTVLKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 E + +T +KGTS + FEFKAP S MY+FCF NPYST Sbjct: 82 ENVVHT-MKGTSGNKFEFKAPRSGMYKFCFKNPYST 116 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIH+GHIP Sbjct: 118 ETVSFYIHIGHIP 130 >ref|XP_004247610.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like [Solanum lycopersicum] Length = 218 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 94 EEIQYTVLKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 E + +T +KGTS + FEFKAP S MY+FCF NPYST Sbjct: 82 ENVVHT-MKGTSGNKFEFKAPRSGMYKFCFKNPYST 116 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIH+GHIP Sbjct: 118 ETVSFYIHIGHIP 130 >ref|XP_006443971.1| hypothetical protein CICLE_v10024247mg [Citrus clementina] gi|568851941|ref|XP_006479641.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like [Citrus sinensis] gi|557546233|gb|ESR57211.1| hypothetical protein CICLE_v10024247mg [Citrus clementina] Length = 212 Score = 48.5 bits (114), Expect(2) = 3e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 LKGTS D F FKAP S MYQFCF+NP ST Sbjct: 82 LKGTSGDKFVFKAPRSGMYQFCFHNPTST 110 Score = 28.1 bits (61), Expect(2) = 3e-06 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 + +SFYIH+GHIP Sbjct: 112 EEVSFYIHIGHIP 124 >ref|XP_007200451.1| hypothetical protein PRUPE_ppa011262mg [Prunus persica] gi|462395851|gb|EMJ01650.1| hypothetical protein PRUPE_ppa011262mg [Prunus persica] Length = 217 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +1 Query: 115 LKGTSRDNFEFKAPPSEMYQFCFYNPYST 201 LKGTS D FEFKAP S +Y+FCF NP ST Sbjct: 87 LKGTSGDKFEFKAPQSGIYKFCFRNPVST 115 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +3 Query: 204 KSISFYIHVGHIP 242 +++SFYIHVGHIP Sbjct: 117 ETVSFYIHVGHIP 129