BLASTX nr result
ID: Paeonia22_contig00021131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00021131 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB44293.1| hypothetical protein L484_012212 [Morus notabilis] 75 1e-11 ref|XP_002272339.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_007010634.1| Pentatricopeptide repeat-containing protein,... 71 2e-10 ref|XP_007010632.1| Pentatricopeptide repeat-containing protein,... 71 2e-10 ref|XP_004308191.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 67 2e-09 ref|XP_002525572.1| pentatricopeptide repeat-containing protein,... 66 6e-09 ref|XP_004147131.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 >gb|EXB44293.1| hypothetical protein L484_012212 [Morus notabilis] Length = 710 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/62 (56%), Positives = 46/62 (74%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 GN+ DAC L+S MV+H LPN T R +VLGFE+K +PV+S+ +KLQE+LL G+HV Sbjct: 649 GNMDDACDLISRMVEHDNLPNKLTHRALVLGFEKKRAKNPVESADFKLQEILLRYGVHVV 708 Query: 144 VN 139 VN Sbjct: 709 VN 710 >ref|XP_002272339.1| PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Vitis vinifera] Length = 644 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 GN+ DACHLVS M++HG +PN+ T +VLG+E+K V +PV+ +A+KLQ+LLL GI + Sbjct: 582 GNIDDACHLVSMMIEHGIMPNNITHHALVLGYEKKCVENPVERAAFKLQQLLLKYGIQAE 641 >ref|XP_007010634.1| Pentatricopeptide repeat-containing protein, putative isoform 3 [Theobroma cacao] gi|508727547|gb|EOY19444.1| Pentatricopeptide repeat-containing protein, putative isoform 3 [Theobroma cacao] Length = 533 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/62 (54%), Positives = 48/62 (77%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 GN+ +AC+LV+ MV++G LPN+ T + VLGFE+K V +P +S+A KLQ+LLL IHVD Sbjct: 472 GNMDEACNLVTMMVRNGILPNNVTHQAFVLGFEKKWVKNPEESAALKLQQLLLRHDIHVD 531 Query: 144 VN 139 V+ Sbjct: 532 VD 533 >ref|XP_007010632.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590567863|ref|XP_007010633.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508727545|gb|EOY19442.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508727546|gb|EOY19443.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 661 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/62 (54%), Positives = 48/62 (77%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 GN+ +AC+LV+ MV++G LPN+ T + VLGFE+K V +P +S+A KLQ+LLL IHVD Sbjct: 600 GNMDEACNLVTMMVRNGILPNNVTHQAFVLGFEKKWVKNPEESAALKLQQLLLRHDIHVD 659 Query: 144 VN 139 V+ Sbjct: 660 VD 661 >ref|XP_004308191.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g19280-like [Fragaria vesca subsp. vesca] Length = 599 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/67 (44%), Positives = 46/67 (68%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 G++ DAC+L+ MV++G LPN+ T R +VLGF +KGV +PV +A+ LQE+ GI D Sbjct: 509 GSIDDACNLICMMVENGILPNNITHRALVLGFGKKGVRNPVLVAAHNLQEICFRYGIRAD 568 Query: 144 VNQYLAM 124 +Y+ + Sbjct: 569 FEEYIKL 575 >ref|XP_002525572.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535151|gb|EEF36831.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 687 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/71 (45%), Positives = 48/71 (67%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 GN+ AC+LV+ M+ G LPN T R LGFE+K V +P ++ KL+++LL +D Sbjct: 615 GNMNAACNLVAMMIDDGFLPNITTHRAFALGFEKKWVKNPELHASLKLKQILLTHSTCLD 674 Query: 144 VNQYLAMMQKP 112 V+++LAMMQ+P Sbjct: 675 VDEHLAMMQQP 685 >ref|XP_004147131.1| PREDICTED: pentatricopeptide repeat-containing protein At2g19280-like [Cucumis sativus] gi|449503522|ref|XP_004162044.1| PREDICTED: pentatricopeptide repeat-containing protein At2g19280-like [Cucumis sativus] Length = 532 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/65 (41%), Positives = 45/65 (69%) Frame = -3 Query: 324 GNVGDACHLVSTMVKHGTLPNDATLRVIVLGFERKGVSDPVKSSAYKLQELLLDCGIHVD 145 GNV + C+LV M++ +PN+ T R +VLGF++K V+DP++S+ KLQE+L+ + +D Sbjct: 468 GNVDEGCNLVKKMIESSIIPNNVTHRALVLGFQKKRVTDPIQSATSKLQEILIAYDLQID 527 Query: 144 VNQYL 130 Y+ Sbjct: 528 AIGYI 532