BLASTX nr result
ID: Paeonia22_contig00020847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00020847 (1639 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 42 3e-06 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +3 Query: 1557 P*LFALVMDDLTSHIQDKITRCMLFA 1634 P LFALVMD+LT HIQD I CMLFA Sbjct: 373 PYLFALVMDELTGHIQDDIPWCMLFA 398 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +2 Query: 1457 AIKGIYD*CVTIMRTPVGETNEFPINVSLHQGPAMT 1564 AIK +Y+ T +RT G+T FPI V LHQG +++ Sbjct: 337 AIKDMYEGAKTAVRTYEGQTESFPITVGLHQGSSLS 372