BLASTX nr result
ID: Paeonia22_contig00020823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00020823 (611 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846776.1| hypothetical protein AMTR_s00148p00031480 [A... 42 6e-06 >ref|XP_006846776.1| hypothetical protein AMTR_s00148p00031480 [Amborella trichopoda] gi|548849598|gb|ERN08357.1| hypothetical protein AMTR_s00148p00031480 [Amborella trichopoda] Length = 322 Score = 41.6 bits (96), Expect(2) = 6e-06 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = -3 Query: 546 KGWNKQAGAFPMQKE*R*GSEDHSYAIRKVLEETGFDV 433 KGW + +FP K+ + EDH+ A+R+VLEETGFDV Sbjct: 125 KGWKVPSWSFPRGKKNK-DEEDHACAVREVLEETGFDV 161 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 20/79 (25%) Frame = -1 Query: 419 GQQRVCLYIVSGVK*QG------------------NDLMTSGQQV-TK*Y-LMGYMVTPF 300 GQQRV LYI++GVK ++L +G + + Y L +MV PF Sbjct: 176 GQQRVRLYIIAGVKEDTVFAPQTKKEISEIAWHHLDELHPTGYETGNRAYKLKLFMVCPF 235 Query: 299 LSSLRS*VSAHKAAIAPKS 243 L L++ ++AH+ + APKS Sbjct: 236 LLPLKAWIAAHRPSTAPKS 254