BLASTX nr result
ID: Paeonia22_contig00020437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00020437 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC36068.1| hypothetical protein L484_001368 [Morus notabilis] 61 2e-07 >gb|EXC36068.1| hypothetical protein L484_001368 [Morus notabilis] Length = 235 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/60 (53%), Positives = 38/60 (63%) Frame = -1 Query: 281 EMFDRCKFRRVEGNIEVPMRWPVDSESVNNRNPYEGDPVHDLSMPLASLSLRDDPETSGT 102 E RC + +GN+ VPM+WPVDS S +E D V LS P+ASLSLRD PETS T Sbjct: 102 EQMTRCIHKSGDGNLFVPMKWPVDSSS------HEADTVQFLSRPMASLSLRDAPETSST 155