BLASTX nr result
ID: Paeonia22_contig00020078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00020078 (657 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55541.1| major facilitator superfamily domain [Rosa rugosa] 60 6e-07 emb|CAB66410.1| putative protein [Arabidopsis thaliana] 60 6e-07 gb|EXC21397.1| hypothetical protein L484_011839 [Morus notabilis] 57 5e-06 ref|XP_006441179.1| hypothetical protein CICLE_v10020083mg [Citr... 57 7e-06 ref|XP_006441178.1| hypothetical protein CICLE_v10020083mg [Citr... 57 7e-06 ref|XP_006404159.1| hypothetical protein EUTSA_v10010332mg [Eutr... 57 7e-06 ref|XP_006404158.1| hypothetical protein EUTSA_v10010332mg [Eutr... 57 7e-06 ref|XP_006391594.1| hypothetical protein EUTSA_v10023452mg [Eutr... 57 7e-06 ref|XP_004986003.1| PREDICTED: major facilitator superfamily dom... 57 7e-06 ref|XP_004986002.1| PREDICTED: major facilitator superfamily dom... 57 7e-06 ref|XP_006302235.1| hypothetical protein CARUB_v10020258mg [Caps... 57 7e-06 ref|XP_006290944.1| hypothetical protein CARUB_v10017059mg, part... 57 7e-06 gb|AAF19685.1|AC009519_19 F1N19.22 [Arabidopsis thaliana] 57 7e-06 ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana... 57 7e-06 tpg|DAA42909.1| TPA: hypothetical protein ZEAMMB73_907505 [Zea m... 57 7e-06 gb|AFW89813.1| hypothetical protein ZEAMMB73_054877 [Zea mays] 57 7e-06 gb|AFW73629.1| hypothetical protein ZEAMMB73_130755 [Zea mays] 57 7e-06 gb|AFW73628.1| hypothetical protein ZEAMMB73_130755 [Zea mays] 57 7e-06 ref|XP_003574207.1| PREDICTED: major facilitator superfamily dom... 57 7e-06 ref|XP_003558980.1| PREDICTED: major facilitator superfamily dom... 57 7e-06 >gb|AFP55541.1| major facilitator superfamily domain [Rosa rugosa] Length = 492 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNKVSVYSSAFAFMILLFK 130 +GRILGGIATSLLFSAFESWLVAEHNKV V+ +M++L + Sbjct: 129 LGRILGGIATSLLFSAFESWLVAEHNKVGVH-----WMVILLR 166 >emb|CAB66410.1| putative protein [Arabidopsis thaliana] Length = 482 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNKVSVYSSAFAFMILLFKLTFKNF 148 VGRILGGIATSLLFSAFESWL+AEHNK++ ++KL+F +F Sbjct: 129 VGRILGGIATSLLFSAFESWLIAEHNKLTRSVLDECKFCSIYKLSFMDF 177 >gb|EXC21397.1| hypothetical protein L484_011839 [Morus notabilis] Length = 459 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 VGRILGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_006441179.1| hypothetical protein CICLE_v10020083mg [Citrus clementina] gi|568877909|ref|XP_006491960.1| PREDICTED: molybdate-anion transporter-like [Citrus sinensis] gi|557543441|gb|ESR54419.1| hypothetical protein CICLE_v10020083mg [Citrus clementina] Length = 459 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 IGRILGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_006441178.1| hypothetical protein CICLE_v10020083mg [Citrus clementina] gi|557543440|gb|ESR54418.1| hypothetical protein CICLE_v10020083mg [Citrus clementina] Length = 452 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 IGRILGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_006404159.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum] gi|557105278|gb|ESQ45612.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum] Length = 476 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGRILGGIATSLLFSAFESWL+AEHNK Sbjct: 145 VGRILGGIATSLLFSAFESWLIAEHNK 171 >ref|XP_006404158.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum] gi|557105277|gb|ESQ45611.1| hypothetical protein EUTSA_v10010332mg [Eutrema salsugineum] Length = 460 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGRILGGIATSLLFSAFESWL+AEHNK Sbjct: 129 VGRILGGIATSLLFSAFESWLIAEHNK 155 >ref|XP_006391594.1| hypothetical protein EUTSA_v10023452mg [Eutrema salsugineum] gi|557088100|gb|ESQ28880.1| hypothetical protein EUTSA_v10023452mg [Eutrema salsugineum] Length = 462 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGR+LGGIATSLLFSAFESWLVAEHNK Sbjct: 129 VGRVLGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_004986003.1| PREDICTED: major facilitator superfamily domain-containing protein 5-like isoform X2 [Setaria italica] Length = 457 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 IGRILGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_004986002.1| PREDICTED: major facilitator superfamily domain-containing protein 5-like isoform X1 [Setaria italica] Length = 467 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 IGRILGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_006302235.1| hypothetical protein CARUB_v10020258mg [Capsella rubella] gi|482570945|gb|EOA35133.1| hypothetical protein CARUB_v10020258mg [Capsella rubella] Length = 462 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGR+LGGIATSLLFSAFESWLVAEHNK Sbjct: 129 VGRVLGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_006290944.1| hypothetical protein CARUB_v10017059mg, partial [Capsella rubella] gi|482559651|gb|EOA23842.1| hypothetical protein CARUB_v10017059mg, partial [Capsella rubella] Length = 503 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGRILGGIATSLLFSAFESWL+AEHNK Sbjct: 172 VGRILGGIATSLLFSAFESWLIAEHNK 198 >gb|AAF19685.1|AC009519_19 F1N19.22 [Arabidopsis thaliana] Length = 474 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGR+LGGIATSLLFSAFESWLVAEHNK Sbjct: 129 VGRVLGGIATSLLFSAFESWLVAEHNK 155 >ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana] gi|12324434|gb|AAG52174.1|AC012329_1 putative transporter; 8780-5873 [Arabidopsis thaliana] gi|40823305|gb|AAR92274.1| At3g49310 [Arabidopsis thaliana] gi|46518411|gb|AAS99687.1| At3g49310 [Arabidopsis thaliana] gi|332645006|gb|AEE78527.1| major facilitator protein [Arabidopsis thaliana] Length = 460 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGRILGGIATSLLFSAFESWL+AEHNK Sbjct: 129 VGRILGGIATSLLFSAFESWLIAEHNK 155 >tpg|DAA42909.1| TPA: hypothetical protein ZEAMMB73_907505 [Zea mays] Length = 457 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 IGRILGGIATSLLFSAFESWLVAEHNK 155 >gb|AFW89813.1| hypothetical protein ZEAMMB73_054877 [Zea mays] Length = 457 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 129 IGRILGGIATSLLFSAFESWLVAEHNK 155 >gb|AFW73629.1| hypothetical protein ZEAMMB73_130755 [Zea mays] Length = 507 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 159 IGRILGGIATSLLFSAFESWLVAEHNK 185 >gb|AFW73628.1| hypothetical protein ZEAMMB73_130755 [Zea mays] Length = 508 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 +GRILGGIATSLLFSAFESWLVAEHNK Sbjct: 159 IGRILGGIATSLLFSAFESWLVAEHNK 185 >ref|XP_003574207.1| PREDICTED: major facilitator superfamily domain-containing protein 5-like [Brachypodium distachyon] Length = 455 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGR+LGGIATSLLFSAFESWLVAEHNK Sbjct: 129 VGRVLGGIATSLLFSAFESWLVAEHNK 155 >ref|XP_003558980.1| PREDICTED: major facilitator superfamily domain-containing protein 5-like [Brachypodium distachyon] Length = 457 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 VGRILGGIATSLLFSAFESWLVAEHNK 82 VGR+LGGIATSLLFSAFESWLVAEHNK Sbjct: 129 VGRVLGGIATSLLFSAFESWLVAEHNK 155