BLASTX nr result
ID: Paeonia22_contig00020017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00020017 (573 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW86285.1| putative dnaJ chaperone family protein [Zea mays] 49 8e-06 ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria ita... 50 8e-06 tpg|DAA39063.1| TPA: putative dnaJ chaperone family protein [Zea... 51 8e-06 >gb|AFW86285.1| putative dnaJ chaperone family protein [Zea mays] Length = 641 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 27/49 (55%), Positives = 31/49 (63%) Frame = -2 Query: 458 MI*PILEPYNNRNRTRETISYTDCFIQCKGNKVVDENKVLEVIVEKGMQ 312 MI + P N + ETIS D QCKG+KVV E KV EV+VEKGMQ Sbjct: 407 MIQQMQHPCNECKGSGETISDKDRCPQCKGDKVVSEKKVFEVVVEKGMQ 455 Score = 26.6 bits (57), Expect(2) = 8e-06 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 553 NDSNGSKSGASGRC 512 N S GSKSGAS RC Sbjct: 375 NSSKGSKSGASSRC 388 >ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica] Length = 418 Score = 50.4 bits (119), Expect(2) = 8e-06 Identities = 28/49 (57%), Positives = 31/49 (63%) Frame = -2 Query: 458 MI*PILEPYNNRNRTRETISYTDCFIQCKGNKVVDENKVLEVIVEKGMQ 312 MI + P N T ETI+ D QCKG KVV E KVLEV+VEKGMQ Sbjct: 184 MIQQMQHPCNECKGTGETINDKDRCPQCKGEKVVQEKKVLEVVVEKGMQ 232 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 550 DSNGSKSGASGRCCSTCGRSRKL 482 + GSKSGAS RC G K+ Sbjct: 153 NGKGSKSGASSRCAGCQGSGYKV 175 >tpg|DAA39063.1| TPA: putative dnaJ chaperone family protein [Zea mays] Length = 336 Score = 51.2 bits (121), Expect(2) = 8e-06 Identities = 28/49 (57%), Positives = 32/49 (65%) Frame = -2 Query: 458 MI*PILEPYNNRNRTRETISYTDCFIQCKGNKVVDENKVLEVIVEKGMQ 312 MI + P N + ETIS D QCKG+KVV E KVLEV+VEKGMQ Sbjct: 146 MIQQMQHPCNECKGSGETISDKDTCPQCKGDKVVSEKKVLEVVVEKGMQ 194 Score = 24.3 bits (51), Expect(2) = 8e-06 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 541 GSKSGASGRCCSTCGRSRKL 482 GSKSGAS RC G K+ Sbjct: 118 GSKSGASSRCAGCQGSGFKV 137