BLASTX nr result
ID: Paeonia22_contig00019317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00019317 (660 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533818.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 >ref|XP_002533818.1| conserved hypothetical protein [Ricinus communis] gi|223526255|gb|EEF28571.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +1 Query: 25 AQPPPSSTTKA-LHGFQADKKTPSFKKVDSSFRRIPPSTSNPTQNK 159 A+P P + + + L GFQ DKK P FK+VDSSFRRIPPSTSNPTQNK Sbjct: 30 ARPDPRAPSLSNLQGFQVDKKNP-FKQVDSSFRRIPPSTSNPTQNK 74