BLASTX nr result
ID: Paeonia22_contig00019236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00019236 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67311.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 64 2e-08 emb|CAN80208.1| hypothetical protein VITISV_010567 [Vitis vinifera] 64 3e-08 ref|XP_006413570.1| hypothetical protein EUTSA_v10024606mg [Eutr... 63 4e-08 ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like prote... 62 8e-08 ref|XP_006284972.1| hypothetical protein CARUB_v10006279mg [Caps... 62 1e-07 gb|EXB50923.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 61 2e-07 ref|XP_006449128.1| hypothetical protein CICLE_v10014521mg [Citr... 60 2e-07 ref|XP_006289355.1| hypothetical protein CARUB_v10002842mg [Caps... 60 2e-07 ref|XP_006286462.1| hypothetical protein CARUB_v10000407mg [Caps... 60 2e-07 ref|XP_002867718.1| predicted protein [Arabidopsis lyrata subsp.... 60 2e-07 ref|NP_192887.1| putative cysteine-rich receptor-like protein ki... 60 2e-07 ref|XP_006413575.1| hypothetical protein EUTSA_v10024643mg [Eutr... 60 3e-07 ref|XP_006413567.1| hypothetical protein EUTSA_v10024894mg [Eutr... 60 3e-07 ref|XP_006396908.1| hypothetical protein EUTSA_v10028508mg [Eutr... 60 3e-07 ref|XP_006396890.1| hypothetical protein EUTSA_v10028491mg [Eutr... 60 3e-07 ref|XP_007025947.1| Cysteine-rich protein, putative isoform 1 [T... 60 3e-07 ref|XP_006286167.1| hypothetical protein CARUB_v10007730mg, part... 60 3e-07 ref|XP_002872590.1| predicted protein [Arabidopsis lyrata subsp.... 60 3e-07 ref|XP_002867719.1| predicted protein [Arabidopsis lyrata subsp.... 60 3e-07 ref|NP_192890.4| putative cysteine-rich receptor-like protein ki... 60 3e-07 >gb|EXB67311.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 383 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLFG 218 RL GFCLEREEKILIYEFVPNKSLDYFLFG Sbjct: 354 RLFGFCLEREEKILIYEFVPNKSLDYFLFG 383 >emb|CAN80208.1| hypothetical protein VITISV_010567 [Vitis vinifera] Length = 614 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLFGMIPLN 203 RLLGFCLE +EKIL+YEFVPNKSLDYFLFG++ L+ Sbjct: 403 RLLGFCLEAKEKILVYEFVPNKSLDYFLFGLLYLH 437 >ref|XP_006413570.1| hypothetical protein EUTSA_v10024606mg [Eutrema salsugineum] gi|557114740|gb|ESQ55023.1| hypothetical protein EUTSA_v10024606mg [Eutrema salsugineum] Length = 670 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLEREEKILIYEFVPNKSLDYFLF Sbjct: 407 RLLGFCLEREEKILIYEFVPNKSLDYFLF 435 >ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like isoform 1 [Vitis vinifera] Length = 663 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLFGM 215 RLLGFCLE EEKIL+YE+VPNKSLDYFLFG+ Sbjct: 392 RLLGFCLEGEEKILVYEYVPNKSLDYFLFGL 422 >ref|XP_006284972.1| hypothetical protein CARUB_v10006279mg [Capsella rubella] gi|482553677|gb|EOA17870.1| hypothetical protein CARUB_v10006279mg [Capsella rubella] Length = 654 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLER+EKIL+YEFVPNKSLDYFLF Sbjct: 393 RLLGFCLERDEKILVYEFVPNKSLDYFLF 421 >gb|EXB50923.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 1170 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLER+EKILIYE+VPNKSLDYFLF Sbjct: 870 RLLGFCLERDEKILIYEYVPNKSLDYFLF 898 >ref|XP_006449128.1| hypothetical protein CICLE_v10014521mg [Citrus clementina] gi|567913631|ref|XP_006449129.1| hypothetical protein CICLE_v10014521mg [Citrus clementina] gi|557551739|gb|ESR62368.1| hypothetical protein CICLE_v10014521mg [Citrus clementina] gi|557551740|gb|ESR62369.1| hypothetical protein CICLE_v10014521mg [Citrus clementina] Length = 429 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLFGMIPL 206 RLLGFCLER+E+IL+YEFVPN SLD+F+FGM L Sbjct: 391 RLLGFCLERKERILVYEFVPNASLDHFIFGMFTL 424 >ref|XP_006289355.1| hypothetical protein CARUB_v10002842mg [Capsella rubella] gi|482558061|gb|EOA22253.1| hypothetical protein CARUB_v10002842mg [Capsella rubella] Length = 661 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFC+ER+EKIL+YEFVPNKSLDYFLF Sbjct: 392 RLLGFCVERDEKILVYEFVPNKSLDYFLF 420 >ref|XP_006286462.1| hypothetical protein CARUB_v10000407mg [Capsella rubella] gi|482555168|gb|EOA19360.1| hypothetical protein CARUB_v10000407mg [Capsella rubella] Length = 662 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFC+ER+EKIL+YEFVPNKSLDYFLF Sbjct: 393 RLLGFCVERDEKILVYEFVPNKSLDYFLF 421 >ref|XP_002867718.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313554|gb|EFH43977.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 704 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLFGMIPLNICL 194 RLLGF LE EE+IL+YE+VPNKSLDYF+FG L CL Sbjct: 437 RLLGFSLEGEERILVYEYVPNKSLDYFIFGQFQLLFCL 474 >ref|NP_192887.1| putative cysteine-rich receptor-like protein kinase 32 [Arabidopsis thaliana] gi|75334863|sp|Q9LDS6.1|CRK32_ARATH RecName: Full=Putative cysteine-rich receptor-like protein kinase 32; Short=Cysteine-rich RLK32; Flags: Precursor gi|7267848|emb|CAB78191.1| serine/threonine kinase-like protein [Arabidopsis thaliana] gi|7321045|emb|CAB82153.1| serine/threonine kinase-like protein [Arabidopsis thaliana] gi|332657616|gb|AEE83016.1| putative cysteine-rich receptor-like protein kinase 32 [Arabidopsis thaliana] Length = 656 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLFG 218 RLLGFCLER+E+IL+YEFVPNKSL+YFLFG Sbjct: 379 RLLGFCLERDEQILVYEFVPNKSLNYFLFG 408 >ref|XP_006413575.1| hypothetical protein EUTSA_v10024643mg [Eutrema salsugineum] gi|557114745|gb|ESQ55028.1| hypothetical protein EUTSA_v10024643mg [Eutrema salsugineum] Length = 648 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 +LLGFC EREEKIL+YEFVPNKSLDYFLF Sbjct: 384 KLLGFCFEREEKILVYEFVPNKSLDYFLF 412 >ref|XP_006413567.1| hypothetical protein EUTSA_v10024894mg [Eutrema salsugineum] gi|557114737|gb|ESQ55020.1| hypothetical protein EUTSA_v10024894mg [Eutrema salsugineum] Length = 530 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLE EEKIL+YEFVPNKSLDYFLF Sbjct: 266 RLLGFCLEGEEKILVYEFVPNKSLDYFLF 294 >ref|XP_006396908.1| hypothetical protein EUTSA_v10028508mg [Eutrema salsugineum] gi|557097925|gb|ESQ38361.1| hypothetical protein EUTSA_v10028508mg [Eutrema salsugineum] Length = 639 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLE EEKIL+YEFVPNKSLDYFLF Sbjct: 381 RLLGFCLEGEEKILVYEFVPNKSLDYFLF 409 >ref|XP_006396890.1| hypothetical protein EUTSA_v10028491mg [Eutrema salsugineum] gi|557097907|gb|ESQ38343.1| hypothetical protein EUTSA_v10028491mg [Eutrema salsugineum] Length = 677 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLE EEKIL+YEFVPNKSLDYFLF Sbjct: 410 RLLGFCLEGEEKILVYEFVPNKSLDYFLF 438 >ref|XP_007025947.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao] gi|508781313|gb|EOY28569.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao] Length = 638 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 304 LLGFCLEREEKILIYEFVPNKSLDYFLFG 218 LLGFCLE EEK+LIYEFVPNKSLDYFLFG Sbjct: 371 LLGFCLEGEEKLLIYEFVPNKSLDYFLFG 399 >ref|XP_006286167.1| hypothetical protein CARUB_v10007730mg, partial [Capsella rubella] gi|482554872|gb|EOA19065.1| hypothetical protein CARUB_v10007730mg, partial [Capsella rubella] Length = 436 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLE EEKIL+YEFVPNKSLDYFLF Sbjct: 408 RLLGFCLEGEEKILVYEFVPNKSLDYFLF 436 >ref|XP_002872590.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318427|gb|EFH48849.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 656 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLER+E+IL+YEFVPNKSLDYFLF Sbjct: 387 RLLGFCLERDEQILVYEFVPNKSLDYFLF 415 >ref|XP_002867719.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313555|gb|EFH43978.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 501 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLE EEKIL+YEFVPNKSLDYFLF Sbjct: 213 RLLGFCLEGEEKILVYEFVPNKSLDYFLF 241 >ref|NP_192890.4| putative cysteine-rich receptor-like protein kinase 35 [Arabidopsis thaliana] gi|332278211|sp|Q9LDQ3.3|CRK35_ARATH RecName: Full=Putative cysteine-rich receptor-like protein kinase 35; Short=Cysteine-rich RLK35; Flags: Precursor gi|332657621|gb|AEE83021.1| cysteine-rich RECEPTOR-like protein kinase 34 [Arabidopsis thaliana] Length = 669 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 307 RLLGFCLEREEKILIYEFVPNKSLDYFLF 221 RLLGFCLE EEKIL+YEFVPNKSLDYFLF Sbjct: 403 RLLGFCLEGEEKILVYEFVPNKSLDYFLF 431