BLASTX nr result
ID: Paeonia22_contig00019205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00019205 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82837.1| hypothetical protein VITISV_030872 [Vitis vinifera] 60 2e-07 ref|XP_007047971.1| Nitric oxide synthase-interacting protein, p... 57 2e-06 >emb|CAN82837.1| hypothetical protein VITISV_030872 [Vitis vinifera] Length = 194 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 106 MGASQYFSSLSCELRIIRAKNIELKQEGNLFVRYY 2 MGASQ SSLSCE+RI+RAKNIELK EG LFVRYY Sbjct: 1 MGASQCLSSLSCEIRIMRAKNIELKTEGKLFVRYY 35 >ref|XP_007047971.1| Nitric oxide synthase-interacting protein, putative [Theobroma cacao] gi|508700232|gb|EOX92128.1| Nitric oxide synthase-interacting protein, putative [Theobroma cacao] Length = 206 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 106 MGASQYFSSLSCELRIIRAKNIELKQEGNLFVRYY 2 MG S Y SSL CELRI++AKN+ELK GNLFVRYY Sbjct: 1 MGISHYLSSLCCELRILQAKNLELKSPGNLFVRYY 35