BLASTX nr result
ID: Paeonia22_contig00018823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00018823 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007221422.1| hypothetical protein PRUPE_ppa007466mg [Prun... 50 8e-06 >ref|XP_007221422.1| hypothetical protein PRUPE_ppa007466mg [Prunus persica] gi|462418152|gb|EMJ22621.1| hypothetical protein PRUPE_ppa007466mg [Prunus persica] Length = 366 Score = 50.1 bits (118), Expect(2) = 8e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 192 PEAVLRDIFKAFPNVANDLKQLLQMIDGGQ 281 P+A+L+ +F FPNV NDLKQLL+MIDGGQ Sbjct: 109 PQAILQGLFNEFPNVGNDLKQLLEMIDGGQ 138 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 19 REKRKERKIKNQERRRTKKME 81 RE+R++R+ K + RRR K E Sbjct: 56 RERREKRRSKRETRRRKSKKE 76