BLASTX nr result
ID: Paeonia22_contig00018677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00018677 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007227410.1| hypothetical protein PRUPE_ppb021321mg [Prun... 56 6e-06 >ref|XP_007227410.1| hypothetical protein PRUPE_ppb021321mg [Prunus persica] gi|462424346|gb|EMJ28609.1| hypothetical protein PRUPE_ppb021321mg [Prunus persica] Length = 203 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = -3 Query: 210 MNDFTKLLANLANLDEVVKDDDRAFILLNSLPPEYEHFRTTLLYGKSTV 64 ++ F + + +L LDEV K +D+A +LL S+PP Y+HF TTL++GK T+ Sbjct: 78 LSSFNRCIEDLQRLDEVYKSEDKAVMLLTSVPPSYKHFCTTLMFGKRTL 126