BLASTX nr result
ID: Paeonia22_contig00018616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00018616 (795 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55546.1| gag-pol polyprotein [Rosa rugosa] 57 8e-06 >gb|AFP55546.1| gag-pol polyprotein [Rosa rugosa] Length = 1180 Score = 57.0 bits (136), Expect = 8e-06 Identities = 31/62 (50%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +1 Query: 565 ILPRR*TRDQPPVT-RFVFSCSTKYPIAKYLSYQGLSAPYHAYVSSISSVQIPRSVSKAM 741 ILP R TR QPP S KYP+AKY+S LS PY A+V+ +SSV +P V AM Sbjct: 618 ILPSRSTRGQPPKHYEPTLSAKAKYPVAKYVSTHRLSKPYAAFVNQLSSVSLPSKVQDAM 677 Query: 742 AD 747 D Sbjct: 678 KD 679