BLASTX nr result
ID: Paeonia22_contig00018514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00018514 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308872.1| hypothetical protein POPTR_0006s03370g [Popu... 51 4e-06 >ref|XP_002308872.1| hypothetical protein POPTR_0006s03370g [Populus trichocarpa] gi|222854848|gb|EEE92395.1| hypothetical protein POPTR_0006s03370g [Populus trichocarpa] Length = 457 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 33/68 (48%), Positives = 36/68 (52%), Gaps = 11/68 (16%) Frame = +3 Query: 60 GEVNPRRPITRSFCAQLLANAQAGEG-----------QNKVPFTEVDGVTGADLHRAVAI 206 G+ P RPITRSFCAQLLANAQA KVP VDGV + R VA+ Sbjct: 53 GKPQPSRPITRSFCAQLLANAQAAAALENNKKQVCVDVEKVPAAGVDGVDA--VGRKVAV 110 Query: 207 KAEVQNKV 230 K Q KV Sbjct: 111 KKPAQKKV 118 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 8 RNRRVLQDIGNMVKI 52 +NRRVL DIGN+V + Sbjct: 34 KNRRVLGDIGNLVTV 48