BLASTX nr result
ID: Paeonia22_contig00017738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00017738 (688 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELR06413.1| hypothetical protein GMDG_02129 [Pseudogymnoascus... 77 4e-12 gb|ELR06412.1| hypothetical protein, variant [Pseudogymnoascus d... 77 4e-12 ref|XP_007294965.1| c2h2 transcription factor [Marssonina brunne... 71 3e-10 gb|EPE33897.1| hypothetical protein GLAREA_06910 [Glarea lozoyen... 62 2e-07 >gb|ELR06413.1| hypothetical protein GMDG_02129 [Pseudogymnoascus destructans 20631-21] Length = 367 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 VQQLQEYGNNHLQYSGYPASPYGAPNQMYNQHNGGPAPKYE 123 VQQLQEY N+H+ YSGYPASPYGAP+QMY+QHNG PAPKYE Sbjct: 326 VQQLQEYSNSHM-YSGYPASPYGAPSQMYSQHNGAPAPKYE 365 >gb|ELR06412.1| hypothetical protein, variant [Pseudogymnoascus destructans 20631-21] Length = 361 Score = 77.4 bits (189), Expect = 4e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 VQQLQEYGNNHLQYSGYPASPYGAPNQMYNQHNGGPAPKYE 123 VQQLQEY N+H+ YSGYPASPYGAP+QMY+QHNG PAPKYE Sbjct: 320 VQQLQEYSNSHM-YSGYPASPYGAPSQMYSQHNGAPAPKYE 359 >ref|XP_007294965.1| c2h2 transcription factor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861812|gb|EKD14865.1| c2h2 transcription factor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 620 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/40 (87%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +1 Query: 1 VQQLQEYGNNHLQYSGYPASPYGAPNQMY-NQHNGG-PAP 114 VQQLQEYG NHLQYSGYPASPYGAPNQMY NQH G PAP Sbjct: 417 VQQLQEYGTNHLQYSGYPASPYGAPNQMYNNQHLGALPAP 456 >gb|EPE33897.1| hypothetical protein GLAREA_06910 [Glarea lozoyensis ATCC 20868] Length = 444 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = +1 Query: 1 VQQLQEYGNNH-LQYSGYPASPYGAPNQMYNQHN-GGPAPKYEH 126 V QLQ Y + +QY GYPASPYG PN MY+QHN GP PKYEH Sbjct: 401 VHQLQNYNSQPGIQYGGYPASPYGQPNPMYSQHNQAGPQPKYEH 444