BLASTX nr result
ID: Paeonia22_contig00017471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00017471 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31743.1| hypothetical protein MIMGU_mgv1a013482mg [Mimulus... 55 8e-06 gb|EPS71680.1| hypothetical protein M569_03080, partial [Genlise... 55 8e-06 >gb|EYU31743.1| hypothetical protein MIMGU_mgv1a013482mg [Mimulus guttatus] Length = 219 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 276 VLECGENIELLVDKTENLSLQVQYFKH*GIKMKRKMW*L*YLKIKLFSYHIF 121 VL+ GE IELLVDKTENL Q Q F+ G KMKRKMW + +KIKL + IF Sbjct: 152 VLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRKMW-VQNMKIKLAVFGIF 202 >gb|EPS71680.1| hypothetical protein M569_03080, partial [Genlisea aurea] Length = 219 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 276 VLECGENIELLVDKTENLSLQVQYFKH*GIKMKRKMW*L*YLKIKLFSYHIF 121 VL+ GE IELLVDKTENL Q Q F+ G +MKRKMW + +KIKL + IF Sbjct: 152 VLDRGEKIELLVDKTENLRSQAQDFRKQGTRMKRKMW-VKNMKIKLIVFGIF 202