BLASTX nr result
ID: Paeonia22_contig00017390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00017390 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352194.1| PREDICTED: glucuronoxylan 4-O-methyltransfer... 56 6e-06 ref|XP_006352193.1| PREDICTED: glucuronoxylan 4-O-methyltransfer... 56 6e-06 ref|XP_002509508.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_002304685.1| hypothetical protein POPTR_0003s17080g [Popu... 56 6e-06 ref|XP_004293059.1| PREDICTED: glucuronoxylan 4-O-methyltransfer... 55 8e-06 >ref|XP_006352194.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Solanum tuberosum] Length = 234 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 6/44 (13%) Frame = -3 Query: 338 TFDVLKSRTPCNFLFFGLSHDSL------TLKERLFLEEDPRWV 225 +FDVLK+RTPCNFL FGL HDS + LFLEEDP+WV Sbjct: 39 SFDVLKNRTPCNFLVFGLGHDSQMWASFNSRGNTLFLEEDPKWV 82 >ref|XP_006352193.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 2-like [Solanum tuberosum] Length = 282 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 6/44 (13%) Frame = -3 Query: 338 TFDVLKSRTPCNFLFFGLSHDSL------TLKERLFLEEDPRWV 225 +FDVLK+RTPCNFL FGL HDS + LFLEEDP+WV Sbjct: 87 SFDVLKNRTPCNFLVFGLGHDSQMWASFNSRGNTLFLEEDPKWV 130 >ref|XP_002509508.1| conserved hypothetical protein [Ricinus communis] gi|223549407|gb|EEF50895.1| conserved hypothetical protein [Ricinus communis] Length = 298 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 6/50 (12%) Frame = -3 Query: 338 TFDVLKSRTPCNFLFFGLSHDSL---TLKER---LFLEEDPRWV*IVVSR 207 +FDVL+S PCNFL FGL HDSL +L R LFLEEDP+WV V+ R Sbjct: 98 SFDVLQSLAPCNFLVFGLGHDSLMWTSLNPRGNTLFLEEDPKWVHTVLQR 147 >ref|XP_002304685.1| hypothetical protein POPTR_0003s17080g [Populus trichocarpa] gi|222842117|gb|EEE79664.1| hypothetical protein POPTR_0003s17080g [Populus trichocarpa] Length = 285 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = -3 Query: 338 TFDVLKSRTPCNFLFFGLSHDSLTLKE------RLFLEEDPRWV*IVVSR 207 TFDVLK+R+PCNFL FGL DSL LFLEEDP+WV +V + Sbjct: 87 TFDVLKTRSPCNFLVFGLGFDSLMWTSLNPHGTTLFLEEDPKWVQTIVKK 136 >ref|XP_004293059.1| PREDICTED: glucuronoxylan 4-O-methyltransferase 1-like [Fragaria vesca subsp. vesca] Length = 280 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 6/43 (13%) Frame = -3 Query: 335 FDVLKSRTPCNFLFFGLSHDSLTLKE------RLFLEEDPRWV 225 FDVLKSR PCNFL FGL HDSL LFLEEDP+W+ Sbjct: 82 FDVLKSRAPCNFLIFGLGHDSLMWVSFNPRGTTLFLEEDPKWL 124