BLASTX nr result
ID: Paeonia22_contig00017335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00017335 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-re... 62 6e-08 >ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-related family protein [Populus trichocarpa] gi|550318276|gb|EEF03294.2| inter-alpha-trypsin inhibitor heavy chain-related family protein [Populus trichocarpa] Length = 752 Score = 62.4 bits (150), Expect = 6e-08 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Frame = +2 Query: 2 QAWFSEDKLLEEKVTKMIIHIGCVFEYTCMM*LETE-GEKRDTGVVSDKVNMSKQVDARG 178 QAWFSE+K LEEKV K+ I G + EYTCM LET+ G + KV + +VD++G Sbjct: 593 QAWFSENKQLEEKVAKLSIQTGVISEYTCMSLLETDRGNQAAESPGGHKVCANLKVDSQG 652 Query: 179 R*KY---NLGIGFDN 214 R + NLG+GF N Sbjct: 653 RRRIFLRNLGVGFGN 667