BLASTX nr result
ID: Paeonia22_contig00017210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00017210 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40527.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002281960.1| PREDICTED: DNA-binding protein RHL1 isoform ... 59 5e-07 >emb|CBI40527.3| unnamed protein product [Vitis vinifera] Length = 369 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -3 Query: 131 MVRASKKKDENG--EVNPEAEERKRLKTLALSKNILSETPAKAYS 3 MVR SKK + G E+NPEAEERKR K LA SKN+LS+TP+KA+S Sbjct: 1 MVRVSKKNENGGVSELNPEAEERKRRKKLAFSKNLLSDTPSKAFS 45 >ref|XP_002281960.1| PREDICTED: DNA-binding protein RHL1 isoform 1 [Vitis vinifera] gi|359489730|ref|XP_003633969.1| PREDICTED: DNA-binding protein RHL1 isoform 2 [Vitis vinifera] Length = 449 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -3 Query: 131 MVRASKKKDENG--EVNPEAEERKRLKTLALSKNILSETPAKAYS 3 MVR SKK + G E+NPEAEERKR K LA SKN+LS+TP+KA+S Sbjct: 1 MVRVSKKNENGGVSELNPEAEERKRRKKLAFSKNLLSDTPSKAFS 45