BLASTX nr result
ID: Paeonia22_contig00017007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00017007 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016781.1| 3'-5'-exoribonuclease family protein isoform... 89 8e-16 ref|XP_006413069.1| hypothetical protein EUTSA_v10026036mg [Eutr... 77 3e-12 ref|XP_006488070.1| PREDICTED: exosome complex component MTR3-li... 72 8e-11 ref|XP_006424544.1| hypothetical protein CICLE_v10029091mg [Citr... 72 8e-11 ref|XP_002869560.1| hypothetical protein ARALYDRAFT_492045 [Arab... 72 1e-10 ref|XP_002529931.1| Exosome complex exonuclease RRP41, putative ... 72 1e-10 gb|EXB38678.1| Exosome complex component [Morus notabilis] 70 2e-10 ref|XP_006284381.1| hypothetical protein CARUB_v10005549mg [Caps... 70 4e-10 ref|NP_194479.2| 3'-5'-exoribonuclease family protein [Arabidops... 69 5e-10 ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [V... 69 7e-10 ref|XP_007132273.1| hypothetical protein PHAVU_011G080900g [Phas... 68 1e-09 emb|CAB43881.1| putative protein [Arabidopsis thaliana] gi|72696... 67 2e-09 ref|XP_004145749.1| PREDICTED: exosome complex component MTR3-li... 66 4e-09 ref|XP_003538176.1| PREDICTED: exosome complex component MTR3-li... 64 2e-08 ref|XP_003606365.1| Exosome complex exonuclease MTR3 [Medicago t... 64 2e-08 ref|XP_004506024.1| PREDICTED: exosome complex component MTR3-li... 62 8e-08 ref|XP_006358710.1| PREDICTED: exosome complex component MTR3-li... 61 2e-07 ref|XP_007205754.1| hypothetical protein PRUPE_ppa010255mg [Prun... 61 2e-07 ref|XP_004240385.1| PREDICTED: exosome complex component MTR3-li... 60 4e-07 gb|EYU18814.1| hypothetical protein MIMGU_mgv1a012266mg [Mimulus... 58 2e-06 >ref|XP_007016781.1| 3'-5'-exoribonuclease family protein isoform 1 [Theobroma cacao] gi|508787144|gb|EOY34400.1| 3'-5'-exoribonuclease family protein isoform 1 [Theobroma cacao] Length = 256 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KPG+ TTYSPSL QKT+PPIFKG DLDWVRPD RGF QCRPAF R Sbjct: 1 MAAKPGSAPTTYSPSLTQKTRPPIFKGNDLDWVRPDGRGFHQCRPAFFR 49 >ref|XP_006413069.1| hypothetical protein EUTSA_v10026036mg [Eutrema salsugineum] gi|557114239|gb|ESQ54522.1| hypothetical protein EUTSA_v10026036mg [Eutrema salsugineum] Length = 256 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KPG +TYSP +V +T+PPIFK DLDW RPD RGF QCRPA L+ Sbjct: 1 MASKPGAATSTYSPKIVARTRPPIFKDSDLDWTRPDGRGFHQCRPALLQ 49 >ref|XP_006488070.1| PREDICTED: exosome complex component MTR3-like [Citrus sinensis] Length = 260 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = +1 Query: 253 MAGKPGTTLT---TYSP-SLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KP TT T TYSP +KT+PPIF G D+DW+RPDSRGF QCRPAF R Sbjct: 1 MAAKPSTTTTAKATYSPIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFR 53 >ref|XP_006424544.1| hypothetical protein CICLE_v10029091mg [Citrus clementina] gi|557526478|gb|ESR37784.1| hypothetical protein CICLE_v10029091mg [Citrus clementina] Length = 260 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = +1 Query: 253 MAGKPGTTLT---TYSP-SLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KP TT T TYSP +KT+PPIF G D+DW+RPDSRGF QCRPAF R Sbjct: 1 MAAKPSTTTTAKATYSPIDPTRKTRPPIFSGSDVDWLRPDSRGFHQCRPAFFR 53 >ref|XP_002869560.1| hypothetical protein ARALYDRAFT_492045 [Arabidopsis lyrata subsp. lyrata] gi|297315396|gb|EFH45819.1| hypothetical protein ARALYDRAFT_492045 [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KPG TYSP LV +T+ PIFK DLDW RPD RGF QCRPA L+ Sbjct: 1 MAAKPGAATPTYSPKLVGRTRLPIFKDSDLDWSRPDGRGFHQCRPALLQ 49 >ref|XP_002529931.1| Exosome complex exonuclease RRP41, putative [Ricinus communis] gi|223530561|gb|EEF32439.1| Exosome complex exonuclease RRP41, putative [Ricinus communis] Length = 180 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KPG+ TTYSP+ +K++PPIFK D+DWVRPD R F +CRPA+ R Sbjct: 1 MASKPGSAPTTYSPTPSRKSRPPIFKHYDVDWVRPDGRSFSECRPAYFR 49 >gb|EXB38678.1| Exosome complex component [Morus notabilis] Length = 257 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 253 MAGKPGTTLTTYSPS-LVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA K +T TTYSPS QKTKP FK +++DWVRPD RGF QCRPAF R Sbjct: 1 MAAKAASTPTTYSPSPTTQKTKPSFFKNDNVDWVRPDGRGFHQCRPAFFR 50 >ref|XP_006284381.1| hypothetical protein CARUB_v10005549mg [Capsella rubella] gi|482553086|gb|EOA17279.1| hypothetical protein CARUB_v10005549mg [Capsella rubella] Length = 256 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KPG TYSP LV +++ P+FK DLDW RPD RGF QCRPA L+ Sbjct: 1 MAAKPGAATPTYSPKLVGRSRLPVFKDSDLDWSRPDGRGFHQCRPALLQ 49 >ref|NP_194479.2| 3'-5'-exoribonuclease family protein [Arabidopsis thaliana] gi|124300968|gb|ABN04736.1| At4g27490 [Arabidopsis thaliana] gi|124301080|gb|ABN04792.1| At4g27490 [Arabidopsis thaliana] gi|332659949|gb|AEE85349.1| 3'-5'-exoribonuclease family protein [Arabidopsis thaliana] Length = 256 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA KPG TYSP +V +++ PIFK DLDW RPD RGF QCRPA L+ Sbjct: 1 MAAKPGAATPTYSPKIVGRSRLPIFKDSDLDWSRPDGRGFHQCRPALLQ 49 >ref|XP_002285257.1| PREDICTED: exosome complex component MTR3 [Vitis vinifera] gi|147834996|emb|CAN61380.1| hypothetical protein VITISV_037546 [Vitis vinifera] gi|297746275|emb|CBI16331.3| unnamed protein product [Vitis vinifera] Length = 254 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK T +TYSPS KTK PIF +D+DWVRPD RGF QCRPAFL+ Sbjct: 1 MAGKSAATPSTYSPSPAPKTKRPIF--QDVDWVRPDGRGFHQCRPAFLK 47 >ref|XP_007132273.1| hypothetical protein PHAVU_011G080900g [Phaseolus vulgaris] gi|561005273|gb|ESW04267.1| hypothetical protein PHAVU_011G080900g [Phaseolus vulgaris] Length = 254 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSL-VQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK G T TYSPSL V K KPP+FK DWVRPD RGF QCRPAF R Sbjct: 1 MAGKGGATPATYSPSLTVDKKKPPLFKE---DWVRPDGRGFHQCRPAFFR 47 >emb|CAB43881.1| putative protein [Arabidopsis thaliana] gi|7269603|emb|CAB81399.1| putative protein [Arabidopsis thaliana] Length = 244 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPA 390 MA KPG TYSP +V +++ PIFK DLDW RPD RGF QCRPA Sbjct: 1 MAAKPGAATPTYSPKIVGRSRLPIFKDSDLDWSRPDGRGFHQCRPA 46 >ref|XP_004145749.1| PREDICTED: exosome complex component MTR3-like [Cucumis sativus] gi|449531263|ref|XP_004172607.1| PREDICTED: exosome complex component MTR3-like [Cucumis sativus] Length = 258 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 253 MAGKPGTTLTTYSPS-LVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA K T TTYSPS V KT+P +F+ +D++WVRPD RGF QCRPAF R Sbjct: 1 MAKKATPTTTTYSPSPTVHKTRPSLFRTDDVNWVRPDGRGFHQCRPAFFR 50 >ref|XP_003538176.1| PREDICTED: exosome complex component MTR3-like [Glycine max] Length = 255 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/51 (66%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLV--QKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK G T TYSPS +K KPPIFK DWVRPD RGF QCRPAF R Sbjct: 1 MAGKGGATPATYSPSPTTNRKKKPPIFKE---DWVRPDGRGFHQCRPAFFR 48 >ref|XP_003606365.1| Exosome complex exonuclease MTR3 [Medicago truncatula] gi|355507420|gb|AES88562.1| Exosome complex exonuclease MTR3 [Medicago truncatula] Length = 258 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/49 (63%), Positives = 33/49 (67%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK GTT TYSPSL K P+ E+ DW RPD RGF QCRPAF R Sbjct: 1 MAGKSGTTPATYSPSLTTGKKKPLLLKEE-DWTRPDGRGFHQCRPAFFR 48 >ref|XP_004506024.1| PREDICTED: exosome complex component MTR3-like [Cicer arietinum] Length = 257 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 253 MAGKPGTTLTTYSP-SLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MA K GTT TYSP K KPP+FK DW+RPD+RGF QCRPAF R Sbjct: 1 MAAKGGTTPATYSPCQTTGKNKPPLFKE---DWIRPDARGFHQCRPAFFR 47 >ref|XP_006358710.1| PREDICTED: exosome complex component MTR3-like [Solanum tuberosum] Length = 255 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK G+T TTYSPS + K I D DWVRPD+RGF QCRPA+LR Sbjct: 1 MAGKSGSTPTTYSPSPATRKKKRI-PIADADWVRPDNRGFYQCRPAYLR 48 >ref|XP_007205754.1| hypothetical protein PRUPE_ppa010255mg [Prunus persica] gi|462401396|gb|EMJ06953.1| hypothetical protein PRUPE_ppa010255mg [Prunus persica] Length = 257 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 253 MAGKPGTTLTTYSPS-LVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK G +TYSPS QKTK IF +D+DWVR D R F QCRPAF + Sbjct: 1 MAGKGGAAPSTYSPSPTTQKTKSRIFGNDDVDWVRSDGREFHQCRPAFFK 50 >ref|XP_004240385.1| PREDICTED: exosome complex component MTR3-like isoform 1 [Solanum lycopersicum] gi|460389492|ref|XP_004240386.1| PREDICTED: exosome complex component MTR3-like isoform 2 [Solanum lycopersicum] Length = 255 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLVQKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK G+T TTYSPS + K I D DWVRPD+RGF QCRPA+L+ Sbjct: 1 MAGKSGSTPTTYSPSPATRKKKRI-PIADADWVRPDNRGFYQCRPAYLK 48 >gb|EYU18814.1| hypothetical protein MIMGU_mgv1a012266mg [Mimulus guttatus] Length = 256 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 253 MAGKPGTTLTTYSPSLV--QKTKPPIFKGEDLDWVRPDSRGFPQCRPAFLR 399 MAGK G+T TYSPSL +K +PP+ D +WVRPD R QCRPAFLR Sbjct: 1 MAGKSGSTPATYSPSLSGQKKKRPPVLA--DSNWVRPDGRTLHQCRPAFLR 49