BLASTX nr result
ID: Paeonia22_contig00016680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00016680 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278615.1| PREDICTED: vesicle transport protein USE1-li... 69 9e-10 emb|CBI30101.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_006493262.1| PREDICTED: uncharacterized protein LOC102608... 66 4e-09 ref|XP_006485180.1| PREDICTED: uncharacterized protein LOC102607... 66 4e-09 ref|XP_006361934.1| PREDICTED: vesicle transport protein USE1-li... 66 4e-09 ref|XP_006353058.1| PREDICTED: vesicle transport protein USE1-li... 66 4e-09 ref|XP_006436905.1| hypothetical protein CICLE_v10032601mg [Citr... 66 4e-09 ref|XP_004233203.1| PREDICTED: vesicle transport protein USE1-li... 66 4e-09 ref|XP_006595567.1| PREDICTED: uncharacterized protein LOC100793... 66 4e-09 ref|NP_001242746.1| uncharacterized protein LOC100793814 [Glycin... 66 4e-09 ref|XP_007154679.1| hypothetical protein PHAVU_003G1387001g, par... 65 1e-08 ref|XP_007015347.1| Ca2+ antiporter/cation exchanger isoform 4 [... 65 1e-08 ref|XP_007015346.1| Ca2+ antiporter/cation exchanger isoform 3 [... 65 1e-08 ref|XP_007015345.1| Ca2+ antiporter/cation exchanger isoform 2 [... 65 1e-08 ref|XP_007015344.1| Ca2+ antiporter/cation exchanger isoform 1 [... 65 1e-08 ref|XP_006600466.1| PREDICTED: uncharacterized protein LOC100811... 65 1e-08 ref|XP_003542288.1| PREDICTED: uncharacterized protein LOC100812... 65 1e-08 gb|ACU19882.1| unknown [Glycine max] 65 1e-08 ref|XP_002519074.1| cation:cation antiporter, putative [Ricinus ... 65 1e-08 gb|EPS63711.1| hypothetical protein M569_11074, partial [Genlise... 65 1e-08 >ref|XP_002278615.1| PREDICTED: vesicle transport protein USE1-like [Vitis vinifera] Length = 245 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 139 IIQD*TMGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 ++QD MG+S+TEVNLRRLLA AP Q N AKL+HYVATLRE LE L++ Sbjct: 1 MVQDPVMGISRTEVNLRRLLAAAPQQQNQAKLIHYVATLREQLEQLSE 48 >emb|CBI30101.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 139 IIQD*TMGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 ++QD MG+S+TEVNLRRLLA AP Q N AKL+HYVATLRE LE L + Sbjct: 55 VVQDLVMGISRTEVNLRRLLAAAPQQQNRAKLIHYVATLREQLEQLTE 102 >ref|XP_006493262.1| PREDICTED: uncharacterized protein LOC102608784 [Citrus sinensis] Length = 149 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTE+NLRRLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEINLRRLLAAAPQQQNQAKLIHYVATLREQLEQLAE 42 >ref|XP_006485180.1| PREDICTED: uncharacterized protein LOC102607374, partial [Citrus sinensis] Length = 114 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTE+NLRRLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEINLRRLLAAAPQQQNQAKLIHYVATLREQLEQLAE 42 >ref|XP_006361934.1| PREDICTED: vesicle transport protein USE1-like isoform X1 [Solanum tuberosum] gi|565392505|ref|XP_006361935.1| PREDICTED: vesicle transport protein USE1-like isoform X2 [Solanum tuberosum] Length = 239 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVNL+RLL AP Q N AKL+HYVATLRELLE LA+ Sbjct: 1 MGMSKTEVNLKRLLVTAPQQQNQAKLIHYVATLRELLEQLAE 42 >ref|XP_006353058.1| PREDICTED: vesicle transport protein USE1-like isoform X1 [Solanum tuberosum] gi|565372972|ref|XP_006353059.1| PREDICTED: vesicle transport protein USE1-like isoform X2 [Solanum tuberosum] gi|565372974|ref|XP_006353060.1| PREDICTED: vesicle transport protein USE1-like isoform X3 [Solanum tuberosum] Length = 239 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLA 279 MGLSKTEVNL+RLL AP Q N AKL+HYVATLRELLE LA Sbjct: 1 MGLSKTEVNLKRLLVTAPQQQNQAKLIHYVATLRELLEQLA 41 >ref|XP_006436905.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] gi|567888768|ref|XP_006436906.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] gi|568880717|ref|XP_006493256.1| PREDICTED: vesicle transport protein USE1-like [Citrus sinensis] gi|557539101|gb|ESR50145.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] gi|557539102|gb|ESR50146.1| hypothetical protein CICLE_v10032601mg [Citrus clementina] Length = 240 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTE+NLRRLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEINLRRLLAAAPQQQNQAKLIHYVATLREQLEQLAE 42 >ref|XP_004233203.1| PREDICTED: vesicle transport protein USE1-like isoform 1 [Solanum lycopersicum] gi|460374814|ref|XP_004233204.1| PREDICTED: vesicle transport protein USE1-like isoform 2 [Solanum lycopersicum] Length = 239 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLA 279 MGLSKTEVNL+RLL AP Q N AKL+HYVATLRELLE LA Sbjct: 1 MGLSKTEVNLKRLLVTAPQQQNQAKLIHYVATLRELLEQLA 41 >ref|XP_006595567.1| PREDICTED: uncharacterized protein LOC100793814 isoform X1 [Glycine max] Length = 240 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVNLRRLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEVNLRRLLAAAPQQQNQAKLVHYVATLREQLEQLAE 42 >ref|NP_001242746.1| uncharacterized protein LOC100793814 [Glycine max] gi|255642275|gb|ACU21402.1| unknown [Glycine max] Length = 240 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVNLRRLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEVNLRRLLAAAPQQQNQAKLVHYVATLREQLEQLAE 42 >ref|XP_007154679.1| hypothetical protein PHAVU_003G1387001g, partial [Phaseolus vulgaris] gi|561028033|gb|ESW26673.1| hypothetical protein PHAVU_003G1387001g, partial [Phaseolus vulgaris] Length = 50 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG++KTEVNLRRLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGINKTEVNLRRLLAAAPQQQNQAKLVHYVATLREQLEQLAE 42 >ref|XP_007015347.1| Ca2+ antiporter/cation exchanger isoform 4 [Theobroma cacao] gi|508785710|gb|EOY32966.1| Ca2+ antiporter/cation exchanger isoform 4 [Theobroma cacao] Length = 234 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVN RRLLA AP Q N +KL+HYVATLRELLE LA+ Sbjct: 1 MGMSKTEVNFRRLLAAAPQQQNHSKLVHYVATLRELLEKLAE 42 >ref|XP_007015346.1| Ca2+ antiporter/cation exchanger isoform 3 [Theobroma cacao] gi|508785709|gb|EOY32965.1| Ca2+ antiporter/cation exchanger isoform 3 [Theobroma cacao] Length = 222 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVN RRLLA AP Q N +KL+HYVATLRELLE LA+ Sbjct: 1 MGMSKTEVNFRRLLAAAPQQQNHSKLVHYVATLRELLEKLAE 42 >ref|XP_007015345.1| Ca2+ antiporter/cation exchanger isoform 2 [Theobroma cacao] gi|508785708|gb|EOY32964.1| Ca2+ antiporter/cation exchanger isoform 2 [Theobroma cacao] Length = 227 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVN RRLLA AP Q N +KL+HYVATLRELLE LA+ Sbjct: 1 MGMSKTEVNFRRLLAAAPQQQNHSKLVHYVATLRELLEKLAE 42 >ref|XP_007015344.1| Ca2+ antiporter/cation exchanger isoform 1 [Theobroma cacao] gi|508785707|gb|EOY32963.1| Ca2+ antiporter/cation exchanger isoform 1 [Theobroma cacao] Length = 239 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVN RRLLA AP Q N +KL+HYVATLRELLE LA+ Sbjct: 1 MGMSKTEVNFRRLLAAAPQQQNHSKLVHYVATLRELLEKLAE 42 >ref|XP_006600466.1| PREDICTED: uncharacterized protein LOC100811568 [Glycine max] Length = 240 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVNL+RLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEVNLKRLLAAAPQQQNQAKLVHYVATLREQLEQLAE 42 >ref|XP_003542288.1| PREDICTED: uncharacterized protein LOC100812755 [Glycine max] Length = 240 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVNL+RLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEVNLKRLLAAAPQQQNQAKLVHYVATLREQLEQLAE 42 >gb|ACU19882.1| unknown [Glycine max] Length = 97 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTEVNL+RLLA AP Q N AKL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEVNLKRLLAAAPQQQNQAKLVHYVATLREQLEQLAE 42 >ref|XP_002519074.1| cation:cation antiporter, putative [Ricinus communis] gi|223541737|gb|EEF43285.1| cation:cation antiporter, putative [Ricinus communis] Length = 202 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MG+SKTE+NLRRLLA AP Q N +KL+HYVATLRE LE LA+ Sbjct: 1 MGISKTEINLRRLLAAAPQQQNQSKLIHYVATLREQLEQLAE 42 >gb|EPS63711.1| hypothetical protein M569_11074, partial [Genlisea aurea] Length = 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +1 Query: 157 MGLSKTEVNLRRLLAVAPLQPNDAKLLHYVATLRELLEHLAQ 282 MGL+KTEVNLRRLLA AP Q N KL+HYVATLRE LE LA+ Sbjct: 1 MGLNKTEVNLRRLLAAAPQQQNQTKLMHYVATLREQLEQLAE 42