BLASTX nr result
ID: Paeonia22_contig00016602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00016602 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266678.2| PREDICTED: auxin response factor 8-like [Vit... 89 6e-16 ref|XP_002526195.1| Auxin response factor, putative [Ricinus com... 89 6e-16 emb|CBI27335.3| unnamed protein product [Vitis vinifera] 89 6e-16 gb|ABN10955.2| auxin response factor 8 [Ipomoea nil] 88 1e-15 ref|XP_006591281.1| PREDICTED: auxin response factor 8-like [Gly... 87 2e-15 ref|XP_006350452.1| PREDICTED: auxin response factor 8-like isof... 87 2e-15 ref|XP_006350451.1| PREDICTED: auxin response factor 8-like isof... 87 2e-15 ref|XP_006350450.1| PREDICTED: auxin response factor 8-like isof... 87 2e-15 ref|XP_006350449.1| PREDICTED: auxin response factor 8-like isof... 87 2e-15 ref|XP_007146950.1| hypothetical protein PHAVU_006G084200g [Phas... 87 2e-15 ref|XP_007146949.1| hypothetical protein PHAVU_006G084200g [Phas... 87 2e-15 ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phas... 87 2e-15 ref|XP_007032138.1| Auxin response factor 8-1 [Theobroma cacao] ... 87 2e-15 ref|XP_004500428.1| PREDICTED: auxin response factor 8-like [Cic... 87 2e-15 ref|XP_004490754.1| PREDICTED: auxin response factor 8-like [Cic... 87 2e-15 ref|XP_004231633.1| PREDICTED: auxin response factor 8 [Solanum ... 87 2e-15 ref|XP_003553137.1| PREDICTED: auxin response factor 8-like [Gly... 87 2e-15 ref|XP_003616115.1| Auxin response factor [Medicago truncatula] ... 87 2e-15 ref|XP_003600594.1| Auxin response factor [Medicago truncatula] ... 87 2e-15 gb|ADG60256.1| ARF8-like protein [Nicotiana tabacum] 87 2e-15 >ref|XP_002266678.2| PREDICTED: auxin response factor 8-like [Vitis vinifera] Length = 846 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP+DVQ+M Sbjct: 767 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKM 807 >ref|XP_002526195.1| Auxin response factor, putative [Ricinus communis] gi|223534499|gb|EEF36199.1| Auxin response factor, putative [Ricinus communis] Length = 826 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP+DVQ+M Sbjct: 773 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKM 813 >emb|CBI27335.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP+DVQ+M Sbjct: 84 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKM 124 >gb|ABN10955.2| auxin response factor 8 [Ipomoea nil] Length = 838 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 760 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKL 800 >ref|XP_006591281.1| PREDICTED: auxin response factor 8-like [Glycine max] Length = 844 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 766 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 806 >ref|XP_006350452.1| PREDICTED: auxin response factor 8-like isoform X2 [Solanum tuberosum] Length = 839 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 761 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKL 801 >ref|XP_006350451.1| PREDICTED: auxin response factor 8-like isoform X1 [Solanum tuberosum] Length = 840 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 762 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKL 802 >ref|XP_006350450.1| PREDICTED: auxin response factor 8-like isoform X2 [Solanum tuberosum] Length = 837 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 759 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKL 799 >ref|XP_006350449.1| PREDICTED: auxin response factor 8-like isoform X1 [Solanum tuberosum] Length = 838 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 760 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKL 800 >ref|XP_007146950.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] gi|561020173|gb|ESW18944.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] Length = 841 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 763 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 803 >ref|XP_007146949.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] gi|561020172|gb|ESW18943.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] Length = 840 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 762 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 802 >ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] gi|561015115|gb|ESW13976.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] Length = 844 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 766 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 806 >ref|XP_007032138.1| Auxin response factor 8-1 [Theobroma cacao] gi|508711167|gb|EOY03064.1| Auxin response factor 8-1 [Theobroma cacao] Length = 838 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPW+AFVNNVWYIKILSP+DVQ+M Sbjct: 760 WQLVFVDRENDILLLGDDPWDAFVNNVWYIKILSPEDVQKM 800 >ref|XP_004500428.1| PREDICTED: auxin response factor 8-like [Cicer arietinum] Length = 853 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 774 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 814 >ref|XP_004490754.1| PREDICTED: auxin response factor 8-like [Cicer arietinum] Length = 833 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 755 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 795 >ref|XP_004231633.1| PREDICTED: auxin response factor 8 [Solanum lycopersicum] Length = 842 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 764 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKL 804 >ref|XP_003553137.1| PREDICTED: auxin response factor 8-like [Glycine max] Length = 841 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 763 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 803 >ref|XP_003616115.1| Auxin response factor [Medicago truncatula] gi|355517450|gb|AES99073.1| Auxin response factor [Medicago truncatula] Length = 841 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 763 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 803 >ref|XP_003600594.1| Auxin response factor [Medicago truncatula] gi|355489642|gb|AES70845.1| Auxin response factor [Medicago truncatula] Length = 849 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDRENDVLLLGDDPWE+FVNNVWYIKILSP+D+Q+M Sbjct: 771 WQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKM 811 >gb|ADG60256.1| ARF8-like protein [Nicotiana tabacum] Length = 119 Score = 87.4 bits (215), Expect = 2e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 379 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPQDVQRM 257 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+DVQ++ Sbjct: 40 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKL 80