BLASTX nr result
ID: Paeonia22_contig00016386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00016386 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270846.1| PREDICTED: uncharacterized protein LOC100262... 84 2e-14 emb|CAN64440.1| hypothetical protein VITISV_017550 [Vitis vinifera] 84 2e-14 gb|EYU38157.1| hypothetical protein MIMGU_mgv1a012400mg [Mimulus... 82 8e-14 ref|NP_197695.1| cell growth defect factor 1 [Arabidopsis thalia... 82 1e-13 ref|XP_002874108.1| hypothetical protein ARALYDRAFT_489157 [Arab... 80 2e-13 ref|XP_002512008.1| conserved hypothetical protein [Ricinus comm... 80 3e-13 gb|EXC25138.1| hypothetical protein L484_004310 [Morus notabilis] 79 5e-13 ref|XP_006376744.1| hypothetical protein POPTR_0012s05430g [Popu... 79 7e-13 ref|XP_007037740.1| Uncharacterized protein TCM_014463 [Theobrom... 79 7e-13 ref|XP_002318556.1| hypothetical protein POPTR_0012s05430g [Popu... 79 7e-13 ref|XP_006288494.1| hypothetical protein CARUB_v10001759mg [Caps... 79 8e-13 ref|XP_007209507.1| hypothetical protein PRUPE_ppa010399mg [Prun... 79 8e-13 ref|XP_006394569.1| hypothetical protein EUTSA_v10004795mg [Eutr... 78 1e-12 ref|XP_004138201.1| PREDICTED: uncharacterized protein LOC101209... 78 1e-12 ref|XP_006844206.1| hypothetical protein AMTR_s00006p00265630 [A... 77 2e-12 ref|XP_004299256.1| PREDICTED: uncharacterized protein LOC101299... 77 2e-12 ref|XP_006494247.1| PREDICTED: uncharacterized protein LOC102618... 77 3e-12 ref|XP_006440869.1| hypothetical protein CICLE_v10021818mg [Citr... 77 3e-12 ref|XP_007155180.1| hypothetical protein PHAVU_003G1802000g, par... 76 4e-12 ref|XP_004236095.1| PREDICTED: uncharacterized protein LOC101267... 75 7e-12 >ref|XP_002270846.1| PREDICTED: uncharacterized protein LOC100262799 [Vitis vinifera] gi|297734138|emb|CBI15385.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGS +VPMIP+ LL+PTWTLELLTSLVAYVFLFLGCTFLK Sbjct: 210 GWVCGSFLVPMIPSFLLRPTWTLELLTSLVAYVFLFLGCTFLK 252 >emb|CAN64440.1| hypothetical protein VITISV_017550 [Vitis vinifera] Length = 235 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGS +VPMIP+ LL+PTWTLELLTSLVAYVFLFLGCTFLK Sbjct: 193 GWVCGSFLVPMIPSFLLRPTWTLELLTSLVAYVFLFLGCTFLK 235 >gb|EYU38157.1| hypothetical protein MIMGU_mgv1a012400mg [Mimulus guttatus] Length = 251 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW+CGS +VP+IP+ LLQPTWTLELLTSLVAYVFLFL CTFLK Sbjct: 209 GWICGSFLVPLIPSFLLQPTWTLELLTSLVAYVFLFLACTFLK 251 >ref|NP_197695.1| cell growth defect factor 1 [Arabidopsis thaliana] gi|9759362|dbj|BAB09821.1| unnamed protein product [Arabidopsis thaliana] gi|21928168|gb|AAM78111.1| AT5g23040/MYJ24_3 [Arabidopsis thaliana] gi|23505829|gb|AAN28774.1| At5g23040/MYJ24_3 [Arabidopsis thaliana] gi|62392260|dbj|BAD95465.1| cell growth defect factor [Arabidopsis thaliana] gi|332005729|gb|AED93112.1| cell growth defect factor 1 [Arabidopsis thaliana] Length = 258 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW CGS+++PMIP L+QPTWTLELLTSLVAYVFLFL CTFLK Sbjct: 216 GWFCGSLIIPMIPTFLIQPTWTLELLTSLVAYVFLFLSCTFLK 258 >ref|XP_002874108.1| hypothetical protein ARALYDRAFT_489157 [Arabidopsis lyrata subsp. lyrata] gi|297319945|gb|EFH50367.1| hypothetical protein ARALYDRAFT_489157 [Arabidopsis lyrata subsp. lyrata] Length = 258 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW CGS+++PMIP L+ PTWTLELLTSLVAYVFLFL CTFLK Sbjct: 216 GWFCGSIIIPMIPTFLIHPTWTLELLTSLVAYVFLFLSCTFLK 258 >ref|XP_002512008.1| conserved hypothetical protein [Ricinus communis] gi|223549188|gb|EEF50677.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGSV VPMIP L+ PTWTLELLTSLVAY+FLF+ CTFLK Sbjct: 214 GWVCGSVFVPMIPTVLIHPTWTLELLTSLVAYLFLFVACTFLK 256 >gb|EXC25138.1| hypothetical protein L484_004310 [Morus notabilis] Length = 248 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGS++VP IP+ LL PTWTLEL TSLV YVFLFLGCTFLK Sbjct: 206 GWVCGSLLVPNIPSVLLHPTWTLELATSLVVYVFLFLGCTFLK 248 >ref|XP_006376744.1| hypothetical protein POPTR_0012s05430g [Populus trichocarpa] gi|550326441|gb|ERP54541.1| hypothetical protein POPTR_0012s05430g [Populus trichocarpa] Length = 265 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGSV VP+IP ++ PTWTLEL+TSLV+Y+FLFLGCTFLK Sbjct: 223 GWVCGSVCVPVIPTVIIPPTWTLELMTSLVSYLFLFLGCTFLK 265 >ref|XP_007037740.1| Uncharacterized protein TCM_014463 [Theobroma cacao] gi|508774985|gb|EOY22241.1| Uncharacterized protein TCM_014463 [Theobroma cacao] Length = 252 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW+CGS+ VPMIP L+ PTWTLELLTSL AYVFLFL CTFLK Sbjct: 210 GWICGSIFVPMIPTVLIHPTWTLELLTSLGAYVFLFLACTFLK 252 >ref|XP_002318556.1| hypothetical protein POPTR_0012s05430g [Populus trichocarpa] gi|222859229|gb|EEE96776.1| hypothetical protein POPTR_0012s05430g [Populus trichocarpa] Length = 266 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGSV VP+IP ++ PTWTLEL+TSLV+Y+FLFLGCTFLK Sbjct: 224 GWVCGSVCVPVIPTVIIPPTWTLELMTSLVSYLFLFLGCTFLK 266 >ref|XP_006288494.1| hypothetical protein CARUB_v10001759mg [Capsella rubella] gi|482557200|gb|EOA21392.1| hypothetical protein CARUB_v10001759mg [Capsella rubella] Length = 258 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW CGS+++PMIP LL PTWTLELLTSLVAY FLFL CTFLK Sbjct: 216 GWFCGSLIIPMIPTVLLNPTWTLELLTSLVAYGFLFLSCTFLK 258 >ref|XP_007209507.1| hypothetical protein PRUPE_ppa010399mg [Prunus persica] gi|462405242|gb|EMJ10706.1| hypothetical protein PRUPE_ppa010399mg [Prunus persica] Length = 251 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGSV+VP IP+ LL PTWTLEL+TSLV YVFLFL CTFLK Sbjct: 209 GWVCGSVLVPNIPSMLLHPTWTLELVTSLVVYVFLFLACTFLK 251 >ref|XP_006394569.1| hypothetical protein EUTSA_v10004795mg [Eutrema salsugineum] gi|557091208|gb|ESQ31855.1| hypothetical protein EUTSA_v10004795mg [Eutrema salsugineum] Length = 257 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW CGS+++PMIP L+ PTWTLELLTSLVAY FLFL CTFLK Sbjct: 215 GWFCGSLIIPMIPTFLIHPTWTLELLTSLVAYAFLFLSCTFLK 257 >ref|XP_004138201.1| PREDICTED: uncharacterized protein LOC101209271 [Cucumis sativus] gi|449525099|ref|XP_004169557.1| PREDICTED: uncharacterized protein LOC101226625 [Cucumis sativus] Length = 251 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGS+VVP IP+ LLQPTW+LELLTSLV Y FLFL CTFLK Sbjct: 209 GWVCGSLVVPSIPSFLLQPTWSLELLTSLVVYFFLFLSCTFLK 251 >ref|XP_006844206.1| hypothetical protein AMTR_s00006p00265630 [Amborella trichopoda] gi|548846605|gb|ERN05881.1| hypothetical protein AMTR_s00006p00265630 [Amborella trichopoda] Length = 207 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW+CGSV+VP IP LL+PTWTLELLT+LV+YVFLFL C FLK Sbjct: 165 GWLCGSVIVPTIPTVLLRPTWTLELLTALVSYVFLFLACAFLK 207 >ref|XP_004299256.1| PREDICTED: uncharacterized protein LOC101299001 [Fragaria vesca subsp. vesca] Length = 252 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWVCGS+++P IP+ L PTWTLELLTSLV YVFLFL CTFLK Sbjct: 210 GWVCGSILIPNIPSMFLNPTWTLELLTSLVVYVFLFLACTFLK 252 >ref|XP_006494247.1| PREDICTED: uncharacterized protein LOC102618127 [Citrus sinensis] Length = 253 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW+ GSVVVPMIP L+ PTWTLELLTSLVAY FLFL CTF K Sbjct: 211 GWILGSVVVPMIPTVLIHPTWTLELLTSLVAYFFLFLACTFFK 253 >ref|XP_006440869.1| hypothetical protein CICLE_v10021818mg [Citrus clementina] gi|557543131|gb|ESR54109.1| hypothetical protein CICLE_v10021818mg [Citrus clementina] Length = 253 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW+ GSVVVPMIP L+ PTWTLELLTSLVAY FLFL CTF K Sbjct: 211 GWILGSVVVPMIPTVLIHPTWTLELLTSLVAYFFLFLACTFFK 253 >ref|XP_007155180.1| hypothetical protein PHAVU_003G1802000g, partial [Phaseolus vulgaris] gi|561028534|gb|ESW27174.1| hypothetical protein PHAVU_003G1802000g, partial [Phaseolus vulgaris] Length = 226 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GWV GSVVVP IP+ LL+PTWTLELLTSLV Y+FLF+ CTFLK Sbjct: 184 GWVSGSVVVPNIPSMLLRPTWTLELLTSLVVYIFLFIACTFLK 226 >ref|XP_004236095.1| PREDICTED: uncharacterized protein LOC101267977 [Solanum lycopersicum] Length = 251 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 246 GWVCGSVVVPMIPAALLQPTWTLELLTSLVAYVFLFLGCTFLK 118 GW CGS++VP+IP+ LLQPTW+LELLTSL YVFLFL CTFLK Sbjct: 209 GWFCGSLLVPIIPSFLLQPTWSLELLTSLFIYVFLFLSCTFLK 251