BLASTX nr result
ID: Paeonia22_contig00016221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00016221 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24832.1| Peroxisome biogenesis protein 7 [Morus notabilis] 68 1e-09 ref|XP_004293949.1| PREDICTED: peroxisome biogenesis protein 7-l... 68 1e-09 ref|XP_004134658.1| PREDICTED: peroxisome biogenesis protein 7-l... 68 1e-09 ref|XP_002272882.1| PREDICTED: peroxisome biogenesis protein 7 [... 68 1e-09 emb|CAN72621.1| hypothetical protein VITISV_004948 [Vitis vinifera] 68 1e-09 ref|XP_007148045.1| hypothetical protein PHAVU_006G175800g [Phas... 67 3e-09 ref|XP_003542988.1| PREDICTED: peroxisome biogenesis protein 7-l... 67 3e-09 ref|XP_002317420.2| hypothetical protein POPTR_0011s07330g [Popu... 67 3e-09 ref|XP_007211636.1| hypothetical protein PRUPE_ppa008638mg [Prun... 66 4e-09 ref|XP_006349215.1| PREDICTED: peroxisome biogenesis protein 7-l... 65 7e-09 ref|XP_002534414.1| peroxisomal targeting signal 2 receptor, put... 65 7e-09 dbj|BAH09866.1| peroxin 7 [Nicotiana tabacum] 65 7e-09 gb|EYU28088.1| hypothetical protein MIMGU_mgv1a010372mg [Mimulus... 65 1e-08 ref|XP_004485898.1| PREDICTED: peroxisome biogenesis protein 7-l... 64 2e-08 ref|XP_002305744.1| peroxisomal targeting signal type 2 receptor... 64 2e-08 ref|XP_006366553.1| PREDICTED: peroxisome biogenesis protein 7-l... 63 5e-08 gb|AFL46502.1| transcription factor PEX7 [Capsicum annuum] 63 5e-08 ref|NP_001234299.1| peroxisomal targeting signal type 2 receptor... 63 5e-08 ref|XP_006449507.1| hypothetical protein CICLE_v10015974mg [Citr... 60 4e-07 ref|XP_006855350.1| hypothetical protein AMTR_s00057p00106270 [A... 60 4e-07 >gb|EXC24832.1| Peroxisome biogenesis protein 7 [Morus notabilis] Length = 319 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 290 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 319 >ref|XP_004293949.1| PREDICTED: peroxisome biogenesis protein 7-like [Fragaria vesca subsp. vesca] Length = 319 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 290 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 319 >ref|XP_004134658.1| PREDICTED: peroxisome biogenesis protein 7-like [Cucumis sativus] gi|449479223|ref|XP_004155540.1| PREDICTED: peroxisome biogenesis protein 7-like [Cucumis sativus] Length = 316 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 316 >ref|XP_002272882.1| PREDICTED: peroxisome biogenesis protein 7 [Vitis vinifera] Length = 316 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 316 >emb|CAN72621.1| hypothetical protein VITISV_004948 [Vitis vinifera] Length = 316 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 316 >ref|XP_007148045.1| hypothetical protein PHAVU_006G175800g [Phaseolus vulgaris] gi|561021268|gb|ESW20039.1| hypothetical protein PHAVU_006G175800g [Phaseolus vulgaris] Length = 318 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGL+ASTGWDELVYVWQHGTDPRAP Sbjct: 289 MSVLVEGLMASTGWDELVYVWQHGTDPRAP 318 >ref|XP_003542988.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X1 [Glycine max] gi|571499880|ref|XP_006594554.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X2 [Glycine max] gi|571499885|ref|XP_006594555.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X3 [Glycine max] gi|571499888|ref|XP_006594556.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X4 [Glycine max] Length = 318 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGL+ASTGWDELVYVWQHGTDPRAP Sbjct: 289 MSVLVEGLMASTGWDELVYVWQHGTDPRAP 318 >ref|XP_002317420.2| hypothetical protein POPTR_0011s07330g [Populus trichocarpa] gi|550327863|gb|EEE98032.2| hypothetical protein POPTR_0011s07330g [Populus trichocarpa] Length = 212 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLV+GLLASTGWDELVYVWQHGTDPRAP Sbjct: 183 MSVLVDGLLASTGWDELVYVWQHGTDPRAP 212 >ref|XP_007211636.1| hypothetical protein PRUPE_ppa008638mg [Prunus persica] gi|462407501|gb|EMJ12835.1| hypothetical protein PRUPE_ppa008638mg [Prunus persica] Length = 324 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDEL YVWQHGTDPRAP Sbjct: 295 MSVLVEGLLASTGWDELAYVWQHGTDPRAP 324 >ref|XP_006349215.1| PREDICTED: peroxisome biogenesis protein 7-like [Solanum tuberosum] Length = 316 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHG DPRAP Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGMDPRAP 316 >ref|XP_002534414.1| peroxisomal targeting signal 2 receptor, putative [Ricinus communis] gi|223525344|gb|EEF27971.1| peroxisomal targeting signal 2 receptor, putative [Ricinus communis] Length = 318 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGL+ STGWDELVYVWQHGTDPRAP Sbjct: 289 MSVLVEGLIGSTGWDELVYVWQHGTDPRAP 318 >dbj|BAH09866.1| peroxin 7 [Nicotiana tabacum] Length = 316 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 MSVLVEGLLASTGWDELVYVWQHG DPRAP Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGMDPRAP 316 >gb|EYU28088.1| hypothetical protein MIMGU_mgv1a010372mg [Mimulus guttatus] Length = 314 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGLLASTGWDELVYVWQHGTDPRA Sbjct: 285 MSVLVEGLLASTGWDELVYVWQHGTDPRA 313 >ref|XP_004485898.1| PREDICTED: peroxisome biogenesis protein 7-like [Cicer arietinum] Length = 318 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGL+ASTGWDELVYVWQHGTDPRA Sbjct: 289 MSVLVEGLIASTGWDELVYVWQHGTDPRA 317 >ref|XP_002305744.1| peroxisomal targeting signal type 2 receptor family protein [Populus trichocarpa] gi|222848708|gb|EEE86255.1| peroxisomal targeting signal type 2 receptor family protein [Populus trichocarpa] Length = 318 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRAP 195 +SVLV+GL+ASTGWDELVYVWQHGTDPRAP Sbjct: 289 ISVLVDGLMASTGWDELVYVWQHGTDPRAP 318 >ref|XP_006366553.1| PREDICTED: peroxisome biogenesis protein 7-like [Solanum tuberosum] Length = 316 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGLLASTGWDELVYVWQHG DPRA Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGMDPRA 315 >gb|AFL46502.1| transcription factor PEX7 [Capsicum annuum] Length = 316 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGLLASTGWDELVYVWQHG DPRA Sbjct: 287 MSVLVEGLLASTGWDELVYVWQHGMDPRA 315 >ref|NP_001234299.1| peroxisomal targeting signal type 2 receptor [Solanum lycopersicum] gi|28195239|gb|AAO27452.1| peroxisomal targeting signal type 2 receptor [Solanum lycopersicum] Length = 317 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGLLASTGWDELVYVWQHG DPRA Sbjct: 288 MSVLVEGLLASTGWDELVYVWQHGMDPRA 316 >ref|XP_006449507.1| hypothetical protein CICLE_v10015974mg [Citrus clementina] gi|568826569|ref|XP_006467644.1| PREDICTED: peroxisome biogenesis protein 7-like [Citrus sinensis] gi|557552118|gb|ESR62747.1| hypothetical protein CICLE_v10015974mg [Citrus clementina] Length = 317 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGLLASTGWDELVYVWQ G DPRA Sbjct: 288 MSVLVEGLLASTGWDELVYVWQQGMDPRA 316 >ref|XP_006855350.1| hypothetical protein AMTR_s00057p00106270 [Amborella trichopoda] gi|548859116|gb|ERN16817.1| hypothetical protein AMTR_s00057p00106270 [Amborella trichopoda] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 284 MSVLVEGLLASTGWDELVYVWQHGTDPRA 198 MSVLVEGLLAST WD+ VYVWQHGTDPRA Sbjct: 283 MSVLVEGLLASTSWDQAVYVWQHGTDPRA 311