BLASTX nr result
ID: Paeonia22_contig00015794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00015794 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429955.1| hypothetical protein CICLE_v10012936mg [Citr... 207 9e-52 ref|XP_004136548.1| PREDICTED: mediator of RNA polymerase II tra... 207 1e-51 ref|XP_002323352.1| hypothetical protein POPTR_0016s06270g [Popu... 206 3e-51 ref|XP_004303373.1| PREDICTED: mediator of RNA polymerase II tra... 205 5e-51 gb|EXB29325.1| Putative mediator of RNA polymerase II transcript... 204 8e-51 ref|XP_007029122.1| Mediator of RNA polymerase II transcription ... 204 8e-51 ref|XP_007029121.1| Mediator of RNA polymerase II transcription ... 204 8e-51 ref|XP_007029120.1| Mediator of RNA polymerase II transcription ... 204 8e-51 ref|XP_006481684.1| PREDICTED: mediator of RNA polymerase II tra... 204 1e-50 ref|XP_007201929.1| hypothetical protein PRUPE_ppa021222mg [Prun... 204 1e-50 ref|XP_004238356.1| PREDICTED: mediator of RNA polymerase II tra... 201 9e-50 ref|XP_002531587.1| Cofactor required for Sp1 transcriptional ac... 201 9e-50 ref|XP_002281390.1| PREDICTED: mediator of RNA polymerase II tra... 199 3e-49 ref|XP_006582942.1| PREDICTED: uncharacterized protein LOC100812... 194 8e-48 dbj|BAF98600.1| CM0545.310.nc [Lotus japonicus] 194 8e-48 ref|XP_007135763.1| hypothetical protein PHAVU_010G156700g [Phas... 192 3e-47 ref|XP_006845795.1| hypothetical protein AMTR_s00019p00255100, p... 192 5e-47 ref|NP_001242689.1| uncharacterized protein LOC100812231 [Glycin... 191 7e-47 gb|AFK46219.1| unknown [Medicago truncatula] 191 9e-47 ref|NP_001241256.1| uncharacterized protein LOC100792250 [Glycin... 191 1e-46 >ref|XP_006429955.1| hypothetical protein CICLE_v10012936mg [Citrus clementina] gi|557532012|gb|ESR43195.1| hypothetical protein CICLE_v10012936mg [Citrus clementina] Length = 168 Score = 207 bits (528), Expect = 9e-52 Identities = 97/106 (91%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN KSAPEPPPPIEGTY+CFG NYTTDDV+PSLEEQGVRQLYPKGPN+DFKKE Sbjct: 14 RLYKDYLQNPKSAPEPPPPIEGTYICFGGNYTTDDVLPSLEEQGVRQLYPKGPNIDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILEL+DVLVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_004136548.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7b-like [Cucumis sativus] Length = 168 Score = 207 bits (527), Expect = 1e-51 Identities = 97/106 (91%), Positives = 105/106 (99%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 KLYKDY+Q+ KSAPEPPPPIEGTYMCFGSNYTTDDV+PSLEEQGVRQLYP+GPNVD+KKE Sbjct: 14 KLYKDYLQDPKSAPEPPPPIEGTYMCFGSNYTTDDVLPSLEEQGVRQLYPRGPNVDYKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELAD+LVERPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADILVERPSQYARRVEEISLIFKNLHHLLNS 119 >ref|XP_002323352.1| hypothetical protein POPTR_0016s06270g [Populus trichocarpa] gi|222867982|gb|EEF05113.1| hypothetical protein POPTR_0016s06270g [Populus trichocarpa] Length = 168 Score = 206 bits (524), Expect = 3e-51 Identities = 98/106 (92%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDYI+N KSAPEPPPPIEGTY+CF S+YTTDDV+PSLEEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYIENPKSAPEPPPPIEGTYVCFASSYTTDDVLPSLEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_004303373.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7b-like [Fragaria vesca subsp. vesca] Length = 175 Score = 205 bits (522), Expect = 5e-51 Identities = 95/106 (89%), Positives = 105/106 (99%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 KLYKDY+Q+ KSAPEPPPPIEGTY+C+G+NYTTDDV+PSLEEQGVRQLYPKGPN+DFKKE Sbjct: 14 KLYKDYLQDPKSAPEPPPPIEGTYICYGANYTTDDVLPSLEEQGVRQLYPKGPNIDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELAD+LVERPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADILVERPSQYARRVEEISLIFKNLHHLLNS 119 >gb|EXB29325.1| Putative mediator of RNA polymerase II transcription subunit 7 [Morus notabilis] Length = 181 Score = 204 bits (520), Expect = 8e-51 Identities = 96/106 (90%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+Q+ KSAP PPPPIEGTY+CFG+NYTTDDV+PS+EEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYLQDPKSAPAPPPPIEGTYVCFGANYTTDDVLPSMEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_007029122.1| Mediator of RNA polymerase II transcription subunit 7 isoform 3 [Theobroma cacao] gi|508717727|gb|EOY09624.1| Mediator of RNA polymerase II transcription subunit 7 isoform 3 [Theobroma cacao] Length = 168 Score = 204 bits (520), Expect = 8e-51 Identities = 96/106 (90%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN KSAPEPPPPIEGTY+CFG +YTTDD++PSLEEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYLQNPKSAPEPPPPIEGTYVCFGGSYTTDDLLPSLEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELADVLVERPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNS 119 >ref|XP_007029121.1| Mediator of RNA polymerase II transcription subunit 7 isoform 2, partial [Theobroma cacao] gi|508717726|gb|EOY09623.1| Mediator of RNA polymerase II transcription subunit 7 isoform 2, partial [Theobroma cacao] Length = 185 Score = 204 bits (520), Expect = 8e-51 Identities = 96/106 (90%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN KSAPEPPPPIEGTY+CFG +YTTDD++PSLEEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYLQNPKSAPEPPPPIEGTYVCFGGSYTTDDLLPSLEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELADVLVERPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNS 119 >ref|XP_007029120.1| Mediator of RNA polymerase II transcription subunit 7 isoform 1 [Theobroma cacao] gi|508717725|gb|EOY09622.1| Mediator of RNA polymerase II transcription subunit 7 isoform 1 [Theobroma cacao] Length = 173 Score = 204 bits (520), Expect = 8e-51 Identities = 96/106 (90%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN KSAPEPPPPIEGTY+CFG +YTTDD++PSLEEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYLQNPKSAPEPPPPIEGTYVCFGGSYTTDDLLPSLEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELADVLVERPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNS 119 >ref|XP_006481684.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Citrus sinensis] Length = 168 Score = 204 bits (519), Expect = 1e-50 Identities = 95/106 (89%), Positives = 103/106 (97%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYK+Y+QN SAPEPPPPIEGTY+CFG NYTTDDV+PSLEEQGVRQLYPKGPN+DFKKE Sbjct: 14 RLYKEYLQNPNSAPEPPPPIEGTYICFGGNYTTDDVLPSLEEQGVRQLYPKGPNIDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILEL+DVLVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_007201929.1| hypothetical protein PRUPE_ppa021222mg [Prunus persica] gi|462397460|gb|EMJ03128.1| hypothetical protein PRUPE_ppa021222mg [Prunus persica] Length = 173 Score = 204 bits (518), Expect = 1e-50 Identities = 93/106 (87%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 KLYKDY+Q+ KSAPEPPPPIEGTY+C+G NYTTDD++PSLE+QGVRQLYPKGPN+D+KKE Sbjct: 14 KLYKDYLQDPKSAPEPPPPIEGTYICYGGNYTTDDILPSLEDQGVRQLYPKGPNIDYKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILELAD+LVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELADILVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_004238356.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7b-like [Solanum lycopersicum] gi|565350175|ref|XP_006342049.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7a-like [Solanum tuberosum] Length = 168 Score = 201 bits (511), Expect = 9e-50 Identities = 95/106 (89%), Positives = 104/106 (98%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+Q+ KSAPEPPPPIEGTY+ FGSNYTTDDV+P+LEEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYLQDPKSAPEPPPPIEGTYVLFGSNYTTDDVLPNLEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L++LNRELQLHILELADVLVERPSQYARRVE+ISLIFKNLHHLLNS Sbjct: 74 LRALNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNS 119 >ref|XP_002531587.1| Cofactor required for Sp1 transcriptional activation subunit, putative [Ricinus communis] gi|223528783|gb|EEF30790.1| Cofactor required for Sp1 transcriptional activation subunit, putative [Ricinus communis] Length = 168 Score = 201 bits (511), Expect = 9e-50 Identities = 95/106 (89%), Positives = 103/106 (97%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDYI+N KSAPEPPPPI+GTY CFG+NYTT+ V+PSLEEQGVRQLYPKGPNVDFKKE Sbjct: 14 RLYKDYIENPKSAPEPPPPIDGTYTCFGANYTTEYVLPSLEEQGVRQLYPKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLHILEL+DVLVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_002281390.1| PREDICTED: mediator of RNA polymerase II transcription subunit 7 [Vitis vinifera] gi|297739781|emb|CBI29963.3| unnamed protein product [Vitis vinifera] Length = 168 Score = 199 bits (507), Expect = 3e-49 Identities = 96/106 (90%), Positives = 101/106 (95%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDYIQN KSAPEPPPPIEGTY FG+ YTTDDV+PSLEEQGVRQLYPKG NVDFKKE Sbjct: 14 RLYKDYIQNPKSAPEPPPPIEGTYALFGATYTTDDVLPSLEEQGVRQLYPKGSNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLNRELQLH+LELADVLVERPSQYARRVEDISLIFKNLHHLLNS Sbjct: 74 LRSLNRELQLHLLELADVLVERPSQYARRVEDISLIFKNLHHLLNS 119 >ref|XP_006582942.1| PREDICTED: uncharacterized protein LOC100812231 isoform X1 [Glycine max] Length = 168 Score = 194 bits (494), Expect = 8e-48 Identities = 88/106 (83%), Positives = 101/106 (95%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN KSAP+PPPPIEGTY+CFG+NYTT DV+P+LEEQGVRQLY KGPNVDFKKE Sbjct: 14 RLYKDYLQNPKSAPDPPPPIEGTYLCFGANYTTSDVLPTLEEQGVRQLYSKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLN ELQLH+LELAD+L+ERPSQYARRVE+IS +FKNLHHLLNS Sbjct: 74 LRSLNGELQLHVLELADILIERPSQYARRVEEISTVFKNLHHLLNS 119 >dbj|BAF98600.1| CM0545.310.nc [Lotus japonicus] Length = 168 Score = 194 bits (494), Expect = 8e-48 Identities = 89/106 (83%), Positives = 100/106 (94%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN SAPEPPPPIEGTY+CFG+NYTT DV+PSLEEQGVRQLY KGPN+DFKKE Sbjct: 14 RLYKDYLQNPDSAPEPPPPIEGTYVCFGANYTTSDVLPSLEEQGVRQLYSKGPNIDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLN ELQLHILELAD+L+ERPSQYARRVE+IS +FKNLHHLLNS Sbjct: 74 LRSLNAELQLHILELADILIERPSQYARRVEEISTVFKNLHHLLNS 119 >ref|XP_007135763.1| hypothetical protein PHAVU_010G156700g [Phaseolus vulgaris] gi|561008808|gb|ESW07757.1| hypothetical protein PHAVU_010G156700g [Phaseolus vulgaris] Length = 168 Score = 192 bits (489), Expect = 3e-47 Identities = 88/106 (83%), Positives = 100/106 (94%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYK+Y+Q+ KSAPEPPPPIEGTY+CFG NYTT DV+PSLEEQGVRQLY KGPNVDFKKE Sbjct: 14 RLYKEYLQDPKSAPEPPPPIEGTYVCFGGNYTTSDVLPSLEEQGVRQLYSKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLN ELQLH+LELAD+L+ERPSQYARRVE+IS +FKNLHHLLNS Sbjct: 74 LRSLNGELQLHVLELADILIERPSQYARRVEEISTVFKNLHHLLNS 119 >ref|XP_006845795.1| hypothetical protein AMTR_s00019p00255100, partial [Amborella trichopoda] gi|548848367|gb|ERN07470.1| hypothetical protein AMTR_s00019p00255100, partial [Amborella trichopoda] Length = 149 Score = 192 bits (487), Expect = 5e-47 Identities = 88/106 (83%), Positives = 102/106 (96%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDYI++ KSAPEPPPPI+GTY +G+ YTTDDV+PSLEEQGVRQLYPKGPN+D+KKE Sbjct: 15 RLYKDYIEDPKSAPEPPPPIDGTYTLYGATYTTDDVLPSLEEQGVRQLYPKGPNIDYKKE 74 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L++LNRELQLH+LELADVLVERPSQYARRVE+ISLIF+NLHHLLNS Sbjct: 75 LRALNRELQLHLLELADVLVERPSQYARRVEEISLIFRNLHHLLNS 120 >ref|NP_001242689.1| uncharacterized protein LOC100812231 [Glycine max] gi|255640472|gb|ACU20522.1| unknown [Glycine max] Length = 161 Score = 191 bits (486), Expect = 7e-47 Identities = 87/106 (82%), Positives = 100/106 (94%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+QN KSAP+PPPPIEGTY+CFG+NYTT DV+P+LEEQGV QLY KGPNVDFKKE Sbjct: 14 RLYKDYLQNPKSAPDPPPPIEGTYLCFGANYTTSDVLPTLEEQGVCQLYSKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLN ELQLH+LELAD+L+ERPSQYARRVE+IS +FKNLHHLLNS Sbjct: 74 LRSLNGELQLHVLELADILIERPSQYARRVEEISTVFKNLHHLLNS 119 >gb|AFK46219.1| unknown [Medicago truncatula] Length = 168 Score = 191 bits (485), Expect = 9e-47 Identities = 87/106 (82%), Positives = 100/106 (94%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+Q+ +SAPEPPPPIEGTY+CFG +YTT DV+PSLEEQGVRQLY KGPN+DFKKE Sbjct: 14 RLYKDYVQDPESAPEPPPPIEGTYICFGGSYTTSDVLPSLEEQGVRQLYSKGPNIDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLN ELQLHILELAD+L+ERPSQYARRVE+IS +FKNLHHLLNS Sbjct: 74 LRSLNGELQLHILELADILIERPSQYARRVEEISTVFKNLHHLLNS 119 >ref|NP_001241256.1| uncharacterized protein LOC100792250 [Glycine max] gi|255645739|gb|ACU23363.1| unknown [Glycine max] Length = 168 Score = 191 bits (484), Expect = 1e-46 Identities = 86/106 (81%), Positives = 100/106 (94%) Frame = -1 Query: 318 KLYKDYIQNSKSAPEPPPPIEGTYMCFGSNYTTDDVIPSLEEQGVRQLYPKGPNVDFKKE 139 +LYKDY+Q+ SAP+PPPPIEGTY+CFG+NYTT DV+P+LEEQGVRQLY KGPNVDFKKE Sbjct: 14 RLYKDYLQDPNSAPDPPPPIEGTYLCFGANYTTSDVLPTLEEQGVRQLYSKGPNVDFKKE 73 Query: 138 LKSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNS 1 L+SLN ELQLH+LELAD+L+ERPSQYARRVE+IS +FKNLHHLLNS Sbjct: 74 LRSLNGELQLHVLELADILIERPSQYARRVEEISTVFKNLHHLLNS 119