BLASTX nr result
ID: Paeonia22_contig00015637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00015637 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211751.1| hypothetical protein PRUPE_ppa009438mg [Prun... 63 8e-13 gb|AGO14648.1| NAC transcription factor [Glycine max] 63 2e-12 ref|NP_001242877.1| uncharacterized protein LOC100779770 [Glycin... 63 2e-12 ref|XP_003523205.1| PREDICTED: NAC domain-containing protein 2 [... 60 1e-11 gb|ACT55332.1| NAC1 [Ipomoea batatas] 59 2e-11 ref|XP_002274177.2| PREDICTED: NAC domain-containing protein 2 i... 58 2e-11 emb|CBI21612.3| unnamed protein product [Vitis vinifera] 58 2e-11 gb|ABZ89746.1| NAC transcription factor ATAF1 [Mikania micrantha... 59 2e-11 ref|XP_003602684.1| NAC-domain protein [Medicago truncatula] gi|... 59 3e-11 ref|XP_002306280.1| hypothetical protein POPTR_0005s07060g [Popu... 57 3e-11 ref|XP_002309945.1| hypothetical protein POPTR_0007s04780g [Popu... 57 3e-11 ref|XP_007159873.1| hypothetical protein PHAVU_002G275000g [Phas... 59 3e-11 ref|XP_003602683.1| NAC-domain protein [Medicago truncatula] gi|... 59 3e-11 ref|XP_004502989.1| PREDICTED: NAC domain-containing protein 2-l... 59 3e-11 ref|XP_004288488.1| PREDICTED: NAC domain-containing protein 2-l... 57 4e-11 gb|ACI15341.1| NAC domain protein NAC1 [Gossypium hirsutum] gi|2... 57 4e-11 gb|ADQ08688.1| NAC transcription factor [Nicotiana tabacum] 58 5e-11 ref|XP_002522919.1| NAC domain-containing protein, putative [Ric... 56 9e-11 gb|AAW48094.1| NAC domain protein 1 [Capsicum annuum] 55 1e-10 gb|ADQ20114.1| NAC domain-containing protein [Chrysanthemum x mo... 57 1e-10 >ref|XP_007211751.1| hypothetical protein PRUPE_ppa009438mg [Prunus persica] gi|462407616|gb|EMJ12950.1| hypothetical protein PRUPE_ppa009438mg [Prunus persica] Length = 292 Score = 62.8 bits (151), Expect(2) = 8e-13 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNNNSRV 93 KGVKTNWIMHEYRLANVDRSA KKNNNN R+ Sbjct: 120 KGVKTNWIMHEYRLANVDRSASKKNNNNLRL 150 Score = 36.2 bits (82), Expect(2) = 8e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 151 DDWVLCRIYNKKGS 164 >gb|AGO14648.1| NAC transcription factor [Glycine max] Length = 295 Score = 62.8 bits (151), Expect(2) = 2e-12 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNNNSRV 93 KGVKTNWIMHEYRLANVDRSA KKNNNN R+ Sbjct: 118 KGVKTNWIMHEYRLANVDRSASKKNNNNLRL 148 Score = 34.7 bits (78), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 149 DDWVLCRIYNKKG 161 >ref|NP_001242877.1| uncharacterized protein LOC100779770 [Glycine max] gi|255640977|gb|ACU20768.1| unknown [Glycine max] Length = 295 Score = 62.8 bits (151), Expect(2) = 2e-12 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNNNSRV 93 KGVKTNWIMHEYRLANVDRSA KKNNNN R+ Sbjct: 118 KGVKTNWIMHEYRLANVDRSASKKNNNNLRL 148 Score = 34.7 bits (78), Expect(2) = 2e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 149 DDWVLCRIYNKKG 161 >ref|XP_003523205.1| PREDICTED: NAC domain-containing protein 2 [Glycine max] Length = 291 Score = 60.5 bits (145), Expect(2) = 1e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNNNSRV 93 KGVKTNWIMHEYRLANVDRSA KK NNN R+ Sbjct: 118 KGVKTNWIMHEYRLANVDRSASKKKNNNLRL 148 Score = 34.7 bits (78), Expect(2) = 1e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 149 DDWVLCRIYNKKG 161 >gb|ACT55332.1| NAC1 [Ipomoea batatas] Length = 300 Score = 58.9 bits (141), Expect(2) = 2e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 KGVKTNWIMHEYRLANVDRSAGKKNN Sbjct: 132 KGVKTNWIMHEYRLANVDRSAGKKNN 157 Score = 35.0 bits (79), Expect(2) = 2e-11 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKG+ Sbjct: 161 DDWVLCRIYNKKGT 174 >ref|XP_002274177.2| PREDICTED: NAC domain-containing protein 2 isoform 2 [Vitis vinifera] Length = 294 Score = 57.8 bits (138), Expect(2) = 2e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 +GVKTNWIMHEYRLANVDRSAGKKNN Sbjct: 120 RGVKTNWIMHEYRLANVDRSAGKKNN 145 Score = 36.2 bits (82), Expect(2) = 2e-11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 149 DDWVLCRIYNKKGS 162 >emb|CBI21612.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 57.8 bits (138), Expect(2) = 2e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 +GVKTNWIMHEYRLANVDRSAGKKNN Sbjct: 120 RGVKTNWIMHEYRLANVDRSAGKKNN 145 Score = 36.2 bits (82), Expect(2) = 2e-11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 149 DDWVLCRIYNKKGS 162 >gb|ABZ89746.1| NAC transcription factor ATAF1 [Mikania micrantha] gi|269856428|gb|ACZ51441.1| NAC transcription factor ATAF1 [Mikania micrantha] Length = 260 Score = 58.9 bits (141), Expect(2) = 2e-11 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNN 81 +GVKTNWIMHEYRLANVDRSAGK+NNN Sbjct: 119 RGVKTNWIMHEYRLANVDRSAGKRNNN 145 Score = 35.0 bits (79), Expect(2) = 2e-11 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKG+ Sbjct: 149 DDWVLCRIYNKKGT 162 >ref|XP_003602684.1| NAC-domain protein [Medicago truncatula] gi|355491732|gb|AES72935.1| NAC-domain protein [Medicago truncatula] Length = 329 Score = 58.9 bits (141), Expect(2) = 3e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 KGVKTNWIMHEYRLANVDRSAGKKNN Sbjct: 118 KGVKTNWIMHEYRLANVDRSAGKKNN 143 Score = 34.7 bits (78), Expect(2) = 3e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 184 DDWVLCRIYNKKG 196 >ref|XP_002306280.1| hypothetical protein POPTR_0005s07060g [Populus trichocarpa] gi|222855729|gb|EEE93276.1| hypothetical protein POPTR_0005s07060g [Populus trichocarpa] Length = 307 Score = 57.4 bits (137), Expect(2) = 3e-11 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 +G+KTNWIMHEYRLANVDRSAGKKNN Sbjct: 125 RGIKTNWIMHEYRLANVDRSAGKKNN 150 Score = 36.2 bits (82), Expect(2) = 3e-11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 154 DDWVLCRIYNKKGS 167 >ref|XP_002309945.1| hypothetical protein POPTR_0007s04780g [Populus trichocarpa] gi|222852848|gb|EEE90395.1| hypothetical protein POPTR_0007s04780g [Populus trichocarpa] Length = 304 Score = 57.4 bits (137), Expect(2) = 3e-11 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 KG+KTNWIMHEYRLANVDR+AGKKNN Sbjct: 123 KGIKTNWIMHEYRLANVDRTAGKKNN 148 Score = 36.2 bits (82), Expect(2) = 3e-11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 152 DDWVLCRIYNKKGS 165 >ref|XP_007159873.1| hypothetical protein PHAVU_002G275000g [Phaseolus vulgaris] gi|561033288|gb|ESW31867.1| hypothetical protein PHAVU_002G275000g [Phaseolus vulgaris] Length = 294 Score = 58.9 bits (141), Expect(2) = 3e-11 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNN 81 KGVKTNWIMHEYRLANVDRSA KKNNN Sbjct: 118 KGVKTNWIMHEYRLANVDRSASKKNNN 144 Score = 34.7 bits (78), Expect(2) = 3e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 148 DDWVLCRIYNKKG 160 >ref|XP_003602683.1| NAC-domain protein [Medicago truncatula] gi|217073174|gb|ACJ84946.1| unknown [Medicago truncatula] gi|355491731|gb|AES72934.1| NAC-domain protein [Medicago truncatula] gi|388500512|gb|AFK38322.1| unknown [Medicago truncatula] Length = 292 Score = 58.9 bits (141), Expect(2) = 3e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 KGVKTNWIMHEYRLANVDRSAGKKNN Sbjct: 118 KGVKTNWIMHEYRLANVDRSAGKKNN 143 Score = 34.7 bits (78), Expect(2) = 3e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 147 DDWVLCRIYNKKG 159 >ref|XP_004502989.1| PREDICTED: NAC domain-containing protein 2-like [Cicer arietinum] Length = 289 Score = 58.9 bits (141), Expect(2) = 3e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 KGVKTNWIMHEYRLANVDRSAGKKNN Sbjct: 118 KGVKTNWIMHEYRLANVDRSAGKKNN 143 Score = 34.7 bits (78), Expect(2) = 3e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 147 DDWVLCRIYNKKG 159 >ref|XP_004288488.1| PREDICTED: NAC domain-containing protein 2-like [Fragaria vesca subsp. vesca] Length = 321 Score = 57.0 bits (136), Expect(2) = 4e-11 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNN 81 KGVKTNWIMHEYRLANVDRSA KKN+N Sbjct: 118 KGVKTNWIMHEYRLANVDRSASKKNHN 144 Score = 36.2 bits (82), Expect(2) = 4e-11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 148 DDWVLCRIYNKKGS 161 >gb|ACI15341.1| NAC domain protein NAC1 [Gossypium hirsutum] gi|206584349|gb|ACI15347.1| NAC domain protein NAC1 [Gossypium hirsutum] Length = 276 Score = 57.0 bits (136), Expect(2) = 4e-11 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNN 81 +GVKTNWIMHEYRLANVDRSAGK++NN Sbjct: 118 RGVKTNWIMHEYRLANVDRSAGKRSNN 144 Score = 36.2 bits (82), Expect(2) = 4e-11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKGS Sbjct: 148 DDWVLCRIYNKKGS 161 >gb|ADQ08688.1| NAC transcription factor [Nicotiana tabacum] Length = 311 Score = 57.8 bits (138), Expect(2) = 5e-11 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNN 81 +G+KTNWIMHEYRLANVDRSAGK NNN Sbjct: 125 RGIKTNWIMHEYRLANVDRSAGKSNNN 151 Score = 35.0 bits (79), Expect(2) = 5e-11 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCRIYNKKG+ Sbjct: 155 DDWVLCRIYNKKGT 168 >ref|XP_002522919.1| NAC domain-containing protein, putative [Ricinus communis] gi|223537846|gb|EEF39462.1| NAC domain-containing protein, putative [Ricinus communis] Length = 349 Score = 56.2 bits (134), Expect(2) = 9e-11 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 KG+KTNWIMHEYRLANVDRSAGKK N Sbjct: 168 KGIKTNWIMHEYRLANVDRSAGKKTN 193 Score = 35.8 bits (81), Expect(2) = 9e-11 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKGS 220 DDWVLCR+YNKKGS Sbjct: 197 DDWVLCRVYNKKGS 210 >gb|AAW48094.1| NAC domain protein 1 [Capsicum annuum] Length = 307 Score = 55.5 bits (132), Expect(2) = 1e-10 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNN 78 +G+KTNWIMHEYRLANVDRSAGK NN Sbjct: 124 RGIKTNWIMHEYRLANVDRSAGKSNN 149 Score = 36.2 bits (82), Expect(2) = 1e-10 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 179 DDWVLCRIYNKKGST 223 DDWVLCRIYNKKG T Sbjct: 153 DDWVLCRIYNKKGHT 167 >gb|ADQ20114.1| NAC domain-containing protein [Chrysanthemum x morifolium] Length = 284 Score = 57.0 bits (136), Expect(2) = 1e-10 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 1 KGVKTNWIMHEYRLANVDRSAGKKNNN 81 +GVKTNWIMHEYRLANVDRSAGK++NN Sbjct: 116 RGVKTNWIMHEYRLANVDRSAGKRSNN 142 Score = 34.7 bits (78), Expect(2) = 1e-10 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 179 DDWVLCRIYNKKG 217 DDWVLCRIYNKKG Sbjct: 146 DDWVLCRIYNKKG 158