BLASTX nr result
ID: Paeonia22_contig00015537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00015537 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29919.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 55 8e-06 emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] 55 8e-06 >emb|CBI29919.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 344 MGLAIGRAQKLWEKGLQPNMREITFAQHPVDSL 442 MGLAIG+AQK WEKGLQPNM+E+T AQ VDSL Sbjct: 93 MGLAIGKAQKWWEKGLQPNMKEVTGAQDLVDSL 125 >ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Vitis vinifera] Length = 311 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 344 MGLAIGRAQKLWEKGLQPNMREITFAQHPVDSL 442 MGLAIG+AQK WEKGLQPNM+E+T AQ VDSL Sbjct: 95 MGLAIGKAQKWWEKGLQPNMKEVTGAQDLVDSL 127 >emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] Length = 311 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 344 MGLAIGRAQKLWEKGLQPNMREITFAQHPVDSL 442 MGLAIG+AQK WEKGLQPNM+E+T AQ VDSL Sbjct: 95 MGLAIGKAQKWWEKGLQPNMKEVTGAQDLVDSL 127