BLASTX nr result
ID: Paeonia22_contig00015424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00015424 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306905.1| hypothetical protein POPTR_0005s25610g [Popu... 58 2e-06 >ref|XP_002306905.1| hypothetical protein POPTR_0005s25610g [Populus trichocarpa] gi|222856354|gb|EEE93901.1| hypothetical protein POPTR_0005s25610g [Populus trichocarpa] Length = 502 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 RLKKEIKGMYRCEGQRAQKVAAISGPSSIHLM 96 R+KKEIKG+YRCE QRAQK AA++GPSSIHL+ Sbjct: 471 RVKKEIKGLYRCEAQRAQKAAAVAGPSSIHLV 502