BLASTX nr result
ID: Paeonia22_contig00014760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00014760 (888 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005650078.1| splicing factor, component of the U5 snRNP a... 47 3e-06 ref|XP_007003317.1| hypothetical protein TREMEDRAFT_38390 [Treme... 46 7e-06 >ref|XP_005650078.1| splicing factor, component of the U5 snRNP and of the spliceosome [Coccomyxa subellipsoidea C-169] gi|384252057|gb|EIE25534.1| splicing factor, component of the U5 snRNP and of the spliceosome [Coccomyxa subellipsoidea C-169] Length = 2308 Score = 46.6 bits (109), Expect(2) = 3e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 3/44 (6%) Frame = -3 Query: 715 EST*LDWAEAVLQVCKKG*NMLNLLIHNRD-SKLHTP--CNLKP 593 +ST LDW EA LQVC++G NMLNLLIH ++ + LH NLKP Sbjct: 457 QSTELDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKP 500 Score = 31.6 bits (70), Expect(2) = 3e-06 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 Query: 791 HHILPKAQK*KHLFSSIQTTKFFQS 717 HH PK K K LF +++ TKFFQS Sbjct: 434 HHRPPKNMKKKSLFKALRATKFFQS 458 >ref|XP_007003317.1| hypothetical protein TREMEDRAFT_38390 [Tremella mesenterica DSM 1558] gi|392577643|gb|EIW70772.1| hypothetical protein TREMEDRAFT_38390 [Tremella mesenterica DSM 1558] Length = 2335 Score = 45.8 bits (107), Expect(2) = 7e-06 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 3/44 (6%) Frame = -3 Query: 715 EST*LDWAEAVLQVCKKG*NMLNLLIHNRD-SKLHTP--CNLKP 593 ++T LDW EA LQVC++G NMLNLLIH ++ + LH NLKP Sbjct: 480 QTTTLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNMNLKP 523 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 791 HHILPKAQK*KHLFSSIQTTKFFQS 717 HH PKA ++LF S+++TKFFQ+ Sbjct: 457 HHKRPKAMVKRNLFRSLKSTKFFQT 481