BLASTX nr result
ID: Paeonia22_contig00014699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00014699 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510987.1| quinone oxidoreductase, putative [Ricinus co... 58 1e-06 ref|XP_004240763.1| PREDICTED: quinone oxidoreductase 1-like [So... 57 2e-06 ref|XP_006385132.1| quinone oxidoreductase-like family protein [... 57 2e-06 ref|XP_002271007.2| PREDICTED: quinone oxidoreductase 1 [Vitis v... 57 3e-06 emb|CBI36442.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CAN83730.1| hypothetical protein VITISV_029360 [Vitis vinifera] 57 3e-06 ref|XP_006490153.1| PREDICTED: probable quinone oxidoreductase-l... 57 3e-06 ref|XP_006421610.1| hypothetical protein CICLE_v10005123mg [Citr... 57 3e-06 ref|XP_002270933.1| PREDICTED: quinone oxidoreductase 1 [Vitis v... 57 3e-06 emb|CAN72117.1| hypothetical protein VITISV_031123 [Vitis vinifera] 57 3e-06 ref|XP_006357919.1| PREDICTED: probable quinone oxidoreductase-l... 56 4e-06 ref|XP_006368385.1| hypothetical protein POPTR_0001s02300g [Popu... 56 4e-06 ref|XP_002466043.1| hypothetical protein SORBIDRAFT_01g050560 [S... 56 6e-06 gb|EXC04325.1| hypothetical protein L484_001759 [Morus notabilis] 55 8e-06 ref|XP_007218342.1| hypothetical protein PRUPE_ppa008633mg [Prun... 55 1e-05 ref|XP_007218340.1| hypothetical protein PRUPE_ppa008622mg [Prun... 55 1e-05 tpg|DAA42799.1| TPA: hypothetical protein ZEAMMB73_834697, parti... 55 1e-05 >ref|XP_002510987.1| quinone oxidoreductase, putative [Ricinus communis] gi|223550102|gb|EEF51589.1| quinone oxidoreductase, putative [Ricinus communis] Length = 323 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAHADLESRKTSGSVVL+P Sbjct: 294 VNHTYPLSQAAQAHADLESRKTSGSVVLIP 323 >ref|XP_004240763.1| PREDICTED: quinone oxidoreductase 1-like [Solanum lycopersicum] Length = 384 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+HTYPL QAAQAH DLESRKTSGSVVL+P+ Sbjct: 351 VNHTYPLSQAAQAHTDLESRKTSGSVVLIPD 381 >ref|XP_006385132.1| quinone oxidoreductase-like family protein [Populus trichocarpa] gi|550341900|gb|ERP62929.1| quinone oxidoreductase-like family protein [Populus trichocarpa] Length = 324 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAHADLESRKTSGSVVL+P Sbjct: 295 VNHTYPLSQAAQAHADLESRKTSGSVVLLP 324 >ref|XP_002271007.2| PREDICTED: quinone oxidoreductase 1 [Vitis vinifera] Length = 395 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+HTYPL QAAQAHADLESRKTSG VVL+P+ Sbjct: 359 VNHTYPLSQAAQAHADLESRKTSGCVVLIPD 389 >emb|CBI36442.3| unnamed protein product [Vitis vinifera] Length = 331 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+HTYPL QAAQAHADLESRKTSG VVL+P+ Sbjct: 295 VNHTYPLSQAAQAHADLESRKTSGCVVLIPD 325 >emb|CAN83730.1| hypothetical protein VITISV_029360 [Vitis vinifera] Length = 331 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+HTYPL QAAQAHADLESRKTSG VVL+P+ Sbjct: 295 VNHTYPLSQAAQAHADLESRKTSGCVVLIPD 325 >ref|XP_006490153.1| PREDICTED: probable quinone oxidoreductase-like [Citrus sinensis] Length = 392 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAH DLESRKTSGSVVL+P Sbjct: 363 VNHTYPLSQAAQAHTDLESRKTSGSVVLIP 392 >ref|XP_006421610.1| hypothetical protein CICLE_v10005123mg [Citrus clementina] gi|557523483|gb|ESR34850.1| hypothetical protein CICLE_v10005123mg [Citrus clementina] Length = 395 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAH DLESRKTSGSVVL+P Sbjct: 366 VNHTYPLSQAAQAHTDLESRKTSGSVVLIP 395 >ref|XP_002270933.1| PREDICTED: quinone oxidoreductase 1 [Vitis vinifera] Length = 333 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+H YPL QAAQAHADLESRKTSGSVVL+P+ Sbjct: 295 VNHKYPLSQAAQAHADLESRKTSGSVVLIPD 325 >emb|CAN72117.1| hypothetical protein VITISV_031123 [Vitis vinifera] Length = 333 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+H YPL QAAQAHADLESRKTSGSVVL+P+ Sbjct: 295 VNHKYPLSQAAQAHADLESRKTSGSVVLIPD 325 >ref|XP_006357919.1| PREDICTED: probable quinone oxidoreductase-like [Solanum tuberosum] Length = 382 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 ++HTYPL QA QAHADLESRKTSGSVVL+P+ Sbjct: 350 MNHTYPLSQAVQAHADLESRKTSGSVVLIPD 380 >ref|XP_006368385.1| hypothetical protein POPTR_0001s02300g [Populus trichocarpa] gi|550346298|gb|ERP64954.1| hypothetical protein POPTR_0001s02300g [Populus trichocarpa] Length = 411 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAHAD+ESRKT+GSVVL+P Sbjct: 382 VNHTYPLSQAAQAHADIESRKTTGSVVLIP 411 >ref|XP_002466043.1| hypothetical protein SORBIDRAFT_01g050560 [Sorghum bicolor] gi|241919897|gb|EER93041.1| hypothetical protein SORBIDRAFT_01g050560 [Sorghum bicolor] Length = 330 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVPE 194 V+HTYPL +AAQAHADLE RKTSGS+VL+P+ Sbjct: 297 VNHTYPLSEAAQAHADLEGRKTSGSIVLIPD 327 >gb|EXC04325.1| hypothetical protein L484_001759 [Morus notabilis] Length = 575 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAHADLE RKT+GSVVL+P Sbjct: 546 VNHTYPLSQAAQAHADLEGRKTTGSVVLIP 575 >ref|XP_007218342.1| hypothetical protein PRUPE_ppa008633mg [Prunus persica] gi|462414804|gb|EMJ19541.1| hypothetical protein PRUPE_ppa008633mg [Prunus persica] Length = 324 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAH DLE+RKTSGSVVL+P Sbjct: 295 VNHTYPLSQAAQAHEDLENRKTSGSVVLIP 324 >ref|XP_007218340.1| hypothetical protein PRUPE_ppa008622mg [Prunus persica] gi|462414802|gb|EMJ19539.1| hypothetical protein PRUPE_ppa008622mg [Prunus persica] Length = 324 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL QAAQAH DLE+RKTSGSVVL+P Sbjct: 295 VNHTYPLSQAAQAHEDLENRKTSGSVVLIP 324 >tpg|DAA42799.1| TPA: hypothetical protein ZEAMMB73_834697, partial [Zea mays] Length = 124 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 286 VHHTYPLCQAAQAHADLESRKTSGSVVLVP 197 V+HTYPL +AAQAHADLE RKTSGS+VL+P Sbjct: 94 VNHTYPLSEAAQAHADLEGRKTSGSIVLIP 123