BLASTX nr result
ID: Paeonia22_contig00014558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00014558 (1281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303363.2| acyl-CoA oxidase family protein [Populus tri... 70 3e-09 ref|XP_006293812.1| hypothetical protein CARUB_v10022793mg [Caps... 70 3e-09 ref|XP_006293811.1| hypothetical protein CARUB_v10022793mg [Caps... 70 3e-09 ref|NP_181112.1| acyl-CoA oxidase 5 [Arabidopsis thaliana] gi|62... 70 3e-09 ref|XP_002879567.1| acyl-CoA oxidase 5 [Arabidopsis lyrata subsp... 70 3e-09 ref|XP_002862393.1| predicted protein [Arabidopsis lyrata subsp.... 70 3e-09 ref|XP_006596700.1| PREDICTED: putative peroxisomal acyl-coenzym... 69 6e-09 ref|NP_001235548.1| acyl-CoA oxidase [Glycine max] gi|15553478|g... 69 6e-09 ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citr... 68 8e-09 ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citr... 68 8e-09 ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citr... 68 8e-09 ref|XP_006410738.1| hypothetical protein EUTSA_v10016360mg [Eutr... 68 8e-09 ref|XP_003611339.1| Peroxisomal acyl-CoA oxidase 1A [Medicago tr... 68 8e-09 ref|XP_006837312.1| hypothetical protein AMTR_s00111p00062720 [A... 68 1e-08 ref|XP_004508938.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 67 1e-08 ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prun... 67 1e-08 ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus tri... 67 2e-08 ref|XP_003608684.1| Peroxisomal acyl-CoA oxidase 1A [Medicago tr... 67 2e-08 ref|XP_007157269.1| hypothetical protein PHAVU_002G056700g [Phas... 66 3e-08 ref|XP_003635297.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 66 3e-08 >ref|XP_002303363.2| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550342653|gb|EEE78342.2| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 663 Score = 69.7 bits (169), Expect = 3e-09 Identities = 37/72 (51%), Positives = 49/72 (68%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF*RVWVDYVLVEGVELL*PTFE 1209 GFIV+L +LDDH PLPGITIGDIGMKFGN YNTMDN + D+V + ++L F+ Sbjct: 203 GFIVQLRSLDDHMPLPGITIGDIGMKFGNGAYNTMDNGV--LTFDHVRIPRNQMLMRVFQ 260 Query: 1210 MSFLDEAVGSTI 1245 ++ + V S + Sbjct: 261 VTREGKCVQSNV 272 >ref|XP_006293812.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] gi|482562520|gb|EOA26710.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] Length = 665 Score = 69.7 bits (169), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF 1146 GFIV+L +LDDHSPLPGIT+GDIGMKFGN YN+MDN F Sbjct: 204 GFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNGF 242 >ref|XP_006293811.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] gi|482562519|gb|EOA26709.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] Length = 562 Score = 69.7 bits (169), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF 1146 GFIV+L +LDDHSPLPGIT+GDIGMKFGN YN+MDN F Sbjct: 204 GFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNGF 242 >ref|NP_181112.1| acyl-CoA oxidase 5 [Arabidopsis thaliana] gi|62286640|sp|Q9ZQP2.1|ACO12_ARATH RecName: Full=Putative peroxisomal acyl-coenzyme A oxidase 1.2 gi|4263786|gb|AAD15446.1| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|18377807|gb|AAL67053.1| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|20465713|gb|AAM20325.1| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|330254051|gb|AEC09145.1| acyl-CoA oxidase 5 [Arabidopsis thaliana] Length = 664 Score = 69.7 bits (169), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF 1146 GFIV+L +LDDHSPLPGIT+GDIGMKFGN YN+MDN F Sbjct: 203 GFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNGF 241 >ref|XP_002879567.1| acyl-CoA oxidase 5 [Arabidopsis lyrata subsp. lyrata] gi|297325406|gb|EFH55826.1| acyl-CoA oxidase 5 [Arabidopsis lyrata subsp. lyrata] Length = 664 Score = 69.7 bits (169), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF 1146 GFIV+L +LDDHSPLPGIT+GDIGMKFGN YN+MDN F Sbjct: 203 GFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNGF 241 >ref|XP_002862393.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297307864|gb|EFH38651.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 357 Score = 69.7 bits (169), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF 1146 GFIV+L +LDDHSPLPGIT+GDIGMKFGN YN+MDN F Sbjct: 203 GFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNGF 241 >ref|XP_006596700.1| PREDICTED: putative peroxisomal acyl-coenzyme A oxidase 1.2-like [Glycine max] Length = 440 Score = 68.6 bits (166), Expect = 6e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LDDH PLPGITIGDIGMKFGN YNTMDN Sbjct: 208 GFIVQLRSLDDHLPLPGITIGDIGMKFGNAAYNTMDN 244 >ref|NP_001235548.1| acyl-CoA oxidase [Glycine max] gi|15553478|gb|AAL01887.1|AF404403_1 acyl-CoA oxidase [Glycine max] Length = 664 Score = 68.6 bits (166), Expect = 6e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LDDH PLPGITIGDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLDDHLPLPGITIGDIGMKFGNAAYNTMDN 239 >ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|567895558|ref|XP_006440267.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542528|gb|ESR53506.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542529|gb|ESR53507.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 529 Score = 68.2 bits (165), Expect = 8e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +L+DHSPLPGITIGDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLEDHSPLPGITIGDIGMKFGNGAYNTMDN 239 >ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542527|gb|ESR53505.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 601 Score = 68.2 bits (165), Expect = 8e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +L+DHSPLPGITIGDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLEDHSPLPGITIGDIGMKFGNGAYNTMDN 239 >ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542526|gb|ESR53504.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 664 Score = 68.2 bits (165), Expect = 8e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +L+DHSPLPGITIGDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLEDHSPLPGITIGDIGMKFGNGAYNTMDN 239 >ref|XP_006410738.1| hypothetical protein EUTSA_v10016360mg [Eutrema salsugineum] gi|557111907|gb|ESQ52191.1| hypothetical protein EUTSA_v10016360mg [Eutrema salsugineum] Length = 664 Score = 68.2 bits (165), Expect = 8e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF 1146 GFIV+L +LDDHSPLPGIT+GDIG+KFGN YN+MDN F Sbjct: 203 GFIVQLRSLDDHSPLPGITVGDIGVKFGNGAYNSMDNGF 241 >ref|XP_003611339.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] gi|355512674|gb|AES94297.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] Length = 664 Score = 68.2 bits (165), Expect = 8e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LDDH PLPGIT+GDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLDDHLPLPGITVGDIGMKFGNAAYNTMDN 239 >ref|XP_006837312.1| hypothetical protein AMTR_s00111p00062720 [Amborella trichopoda] gi|548839930|gb|ERN00166.1| hypothetical protein AMTR_s00111p00062720 [Amborella trichopoda] Length = 664 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +L+DHSPLPGIT+GDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLEDHSPLPGITVGDIGMKFGNGAYNTMDN 239 >ref|XP_004508938.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Cicer arietinum] Length = 664 Score = 67.4 bits (163), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LDDH PLPGITIGDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLDDHLPLPGITIGDIGMKFGNGAYNTMDN 239 >ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] gi|402744131|gb|AFQ93693.1| acyl-CoA oxidase 1 [Prunus persica] gi|462406037|gb|EMJ11501.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] Length = 664 Score = 67.4 bits (163), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L NLDDH PLPGIT+GDIGMKFGN YN+MDN Sbjct: 203 GFIVQLRNLDDHLPLPGITVGDIGMKFGNGAYNSMDN 239 >ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550347354|gb|ERP65564.1| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 664 Score = 67.0 bits (162), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LDDH PLPG+TIGDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLDDHMPLPGLTIGDIGMKFGNGAYNTMDN 239 >ref|XP_003608684.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] gi|355509739|gb|AES90881.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] Length = 664 Score = 67.0 bits (162), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LDDH PLPGIT+GDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLDDHLPLPGITVGDIGMKFGNGAYNTMDN 239 >ref|XP_007157269.1| hypothetical protein PHAVU_002G056700g [Phaseolus vulgaris] gi|561030684|gb|ESW29263.1| hypothetical protein PHAVU_002G056700g [Phaseolus vulgaris] Length = 664 Score = 66.2 bits (160), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDN 1140 GFIV+L +LD+H PLPGIT+GDIGMKFGN YNTMDN Sbjct: 203 GFIVQLRSLDNHLPLPGITVGDIGMKFGNAAYNTMDN 239 >ref|XP_003635297.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Vitis vinifera] Length = 596 Score = 66.2 bits (160), Expect = 3e-08 Identities = 38/80 (47%), Positives = 51/80 (63%) Frame = +1 Query: 1030 GFIVRL*NLDDHSPLPGITIGDIGMKFGNCVYNTMDNDF*RVWVDYVLVEGVELL*PTFE 1209 GFIV+L +L+DH PLPGITIGDIGMKFGN YN+MDN R D+V + ++L F+ Sbjct: 135 GFIVQLRSLEDHLPLPGITIGDIGMKFGNGGYNSMDNGVLR--FDHVRIPRDQMLMRVFQ 192 Query: 1210 MSFLDEAVGSTIAWPSTYIT 1269 ++ + V S + Y T Sbjct: 193 VTREGKCVQSNVPRQLVYGT 212