BLASTX nr result
ID: Paeonia22_contig00014132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00014132 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208892.1| hypothetical protein PRUPE_ppa026736mg [Prun... 83 4e-14 ref|XP_003548696.2| PREDICTED: pentatricopeptide repeat-containi... 83 5e-14 ref|XP_002519926.1| pentatricopeptide repeat-containing protein,... 83 5e-14 ref|XP_004301758.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_002303222.1| hypothetical protein POPTR_0003s03950g [Popu... 78 1e-12 ref|XP_007040884.1| Tetratricopeptide repeat-like superfamily pr... 76 6e-12 ref|XP_004509496.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_003629008.1| Pentatricopeptide repeat-containing protein ... 72 6e-11 emb|CAN82548.1| hypothetical protein VITISV_005814 [Vitis vinifera] 72 1e-10 ref|XP_002269803.2| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_006494102.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_006432897.1| hypothetical protein CICLE_v10000932mg [Citr... 70 4e-10 gb|EYU37434.1| hypothetical protein MIMGU_mgv1a023557mg [Mimulus... 68 1e-09 ref|XP_004166808.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004150822.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 >ref|XP_007208892.1| hypothetical protein PRUPE_ppa026736mg [Prunus persica] gi|462404627|gb|EMJ10091.1| hypothetical protein PRUPE_ppa026736mg [Prunus persica] Length = 481 Score = 83.2 bits (204), Expect = 4e-14 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -3 Query: 324 MDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 +DRLSEL+R ADDMLDR ++IYESTM LK A+YK+GRGARD YD L RRWK + Sbjct: 425 LDRLSELKRNADDMLDRRISIYESTMASLKSAYYKDGRGARDKYDGLARRWKTS 478 >ref|XP_003548696.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Glycine max] Length = 492 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKA 166 NM R +E++RFA+D+LDR +NIY+STM LK AFYKEGR ARD YDSL RRWKA Sbjct: 435 NMSRFTEVKRFAEDILDRRINIYQSTMSILKDAFYKEGRSARDRYDSLYRRWKA 488 >ref|XP_002519926.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540972|gb|EEF42530.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 481 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/55 (67%), Positives = 47/55 (85%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 N+ RLSE+ RFA+DMLDR +NI+ESTM KLK +FYKEGR +RD +DSL R+WKA+ Sbjct: 427 NLGRLSEVSRFAEDMLDRRINIHESTMAKLKASFYKEGRSSRDRFDSLSRKWKAS 481 >ref|XP_004301758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 464 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/54 (64%), Positives = 45/54 (83%) Frame = -3 Query: 324 MDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 +DRLSEL+R ADDMLDR +++YESTM +LK +YK+GRGA+D YD L RRWK + Sbjct: 408 LDRLSELKRCADDMLDRRISVYESTMARLKSVYYKDGRGAKDKYDGLARRWKTS 461 >ref|XP_002303222.1| hypothetical protein POPTR_0003s03950g [Populus trichocarpa] gi|222840654|gb|EEE78201.1| hypothetical protein POPTR_0003s03950g [Populus trichocarpa] Length = 472 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKA 166 N+ R+S++RRFA+DMLDR +NIYESTM KLK +F K GR RD YD L+RRWKA Sbjct: 418 NLGRMSQVRRFAEDMLDRRINIYESTMKKLKDSFDKTGRHGRDKYDCLIRRWKA 471 >ref|XP_007040884.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590680522|ref|XP_007040885.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508778129|gb|EOY25385.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508778130|gb|EOY25386.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 491 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA*M 157 N+ RLS + RFA++MLD+ +N++ESTM KLK AF+KEGR RD YDSL RRWK A M Sbjct: 435 NLGRLSWVERFAEEMLDKRINLFESTMEKLKNAFFKEGRTLRDKYDSLSRRWKVAQM 491 >ref|XP_004509496.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cicer arietinum] Length = 499 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -3 Query: 324 MDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKA 166 + RLSE+RR +++MLD+ + IYESTM KLK FYKEGR RD +DSL RRWKA Sbjct: 443 LSRLSEIRRLSEEMLDKRIIIYESTMTKLKDTFYKEGRSTRDRFDSLYRRWKA 495 >ref|XP_003629008.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523030|gb|AET03484.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 543 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/55 (61%), Positives = 45/55 (81%), Gaps = 2/55 (3%) Frame = -3 Query: 324 MDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGR--GARDTYDSLLRRWKA 166 + RLSE+RRFA++MLD+ ++IY+STM KLK AFYKE R ARD +D++ RRWKA Sbjct: 448 LKRLSEVRRFAEEMLDKRISIYDSTMNKLKEAFYKESRSSSARDKFDAIYRRWKA 502 >emb|CAN82548.1| hypothetical protein VITISV_005814 [Vitis vinifera] Length = 493 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/67 (55%), Positives = 46/67 (68%), Gaps = 3/67 (4%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWK---AA*M 157 N+ R S+ RRFA+DMLD + I+ESTM KLK A YK+GR ARDT DSL +RWK Sbjct: 405 NLRRFSDYRRFAEDMLDMKIKIHESTMEKLKNARYKDGRSARDTCDSLWKRWKLGYVGGF 464 Query: 156 MWLLLSV 136 +W L S+ Sbjct: 465 LWFLGSI 471 >ref|XP_002269803.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] gi|296085476|emb|CBI29208.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 N+ R S+ RRFA+DMLD + I+ESTM KLK A YK+GR ARDT DSL +RWK + Sbjct: 405 NLRRFSDYRRFAEDMLDMKIKIHESTMEKLKNARYKDGRSARDTCDSLWKRWKVS 459 >ref|XP_006494102.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Citrus sinensis] Length = 463 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA*M 157 N+ RLS++RRFA++ML+R + IY+ TM KLK AFY E R RD +DSL RRWK + M Sbjct: 407 NLGRLSDVRRFAEEMLNRRILIYDVTMQKLKKAFYNESRSMRDRFDSLERRWKTSQM 463 >ref|XP_006432897.1| hypothetical protein CICLE_v10000932mg [Citrus clementina] gi|568882584|ref|XP_006494101.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Citrus sinensis] gi|557535019|gb|ESR46137.1| hypothetical protein CICLE_v10000932mg [Citrus clementina] Length = 499 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA*M 157 N+ RLS++RRFA++ML+R + IY+ TM KLK AFY E R RD +DSL RRWK + M Sbjct: 443 NLGRLSDVRRFAEEMLNRRILIYDVTMQKLKKAFYNESRSMRDRFDSLERRWKTSQM 499 >gb|EYU37434.1| hypothetical protein MIMGU_mgv1a023557mg [Mimulus guttatus] Length = 474 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 +M RLS+LRRFA+ M+D + I ESTM K+K FYKEG+G+R+ YD + R+WK++ Sbjct: 418 SMGRLSDLRRFAEKMIDERIIINESTMTKVKNCFYKEGKGSREIYDQISRKWKSS 472 >ref|XP_004166808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 503 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 N++RL+E+RRFADDM+D+ ++I ESTM LK FY++ R+ YD LLRRW+A+ Sbjct: 446 NLNRLTEVRRFADDMIDQRIDILESTMKLLKNCFYQQRGNFRENYDGLLRRWRAS 500 >ref|XP_004150822.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 487 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -3 Query: 327 NMDRLSELRRFADDMLDRGVNIYESTMGKLKVAFYKEGRGARDTYDSLLRRWKAA 163 N++RL+E+RRFADDM+D+ ++I ESTM LK FY++ R+ YD LLRRW+A+ Sbjct: 430 NLNRLTEVRRFADDMIDQRIDILESTMKLLKNCFYQQRGNFRENYDGLLRRWRAS 484