BLASTX nr result
ID: Paeonia22_contig00013766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00013766 (581 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25627.1| hypothetical protein MIMGU_mgv1a004356mg [Mimulus... 74 2e-11 ref|XP_004150082.1| PREDICTED: importin subunit alpha-1-like [Cu... 74 2e-11 ref|XP_006472169.1| PREDICTED: importin subunit alpha-1b-like [C... 72 1e-10 gb|AAT08686.1| karyopherin alpha [Hyacinthus orientalis] 72 1e-10 ref|XP_006488879.1| PREDICTED: importin subunit alpha-1-like [Ci... 72 1e-10 ref|XP_007144986.1| hypothetical protein PHAVU_007G199900g [Phas... 72 1e-10 ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like iso... 72 1e-10 ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Gl... 72 1e-10 ref|XP_006355403.1| PREDICTED: importin subunit alpha-1-like iso... 70 3e-10 ref|XP_007154341.1| hypothetical protein PHAVU_003G110500g [Phas... 70 3e-10 ref|XP_007138966.1| hypothetical protein PHAVU_009G253500g [Phas... 70 3e-10 ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Ci... 70 3e-10 ref|XP_007205032.1| hypothetical protein PRUPE_ppa004091mg [Prun... 70 3e-10 ref|XP_004228994.1| PREDICTED: importin subunit alpha-1a-like [S... 70 3e-10 ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Gl... 70 3e-10 ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like iso... 70 3e-10 ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like iso... 70 3e-10 ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatul... 70 3e-10 ref|XP_002512485.1| importin alpha, putative [Ricinus communis] ... 70 3e-10 ref|XP_002519178.1| importin alpha, putative [Ricinus communis] ... 70 3e-10 >gb|EYU25627.1| hypothetical protein MIMGU_mgv1a004356mg [Mimulus guttatus] gi|604343231|gb|EYU42202.1| hypothetical protein MIMGU_mgv1a004354mg [Mimulus guttatus] Length = 531 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT EHTKVVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 135 FEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLASPSDDVREQAVWALG 184 >ref|XP_004150082.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus] gi|449501502|ref|XP_004161385.1| PREDICTED: importin subunit alpha-1-like [Cucumis sativus] Length = 530 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT EHTKVVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 134 FEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLASPSDDVREQAVWALG 183 >ref|XP_006472169.1| PREDICTED: importin subunit alpha-1b-like [Citrus sinensis] Length = 530 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT EHTKVVIDHG V +FVKLL SPS+DV EQ +G Sbjct: 135 FEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLYSPSDDVREQAVWALG 184 >gb|AAT08686.1| karyopherin alpha [Hyacinthus orientalis] Length = 277 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/50 (70%), Positives = 39/50 (78%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT EHTKVVIDHG V VFV+LL SPS+DV EQ +G Sbjct: 145 FEAAWALTNIASGTSEHTKVVIDHGAVPVFVRLLGSPSDDVREQAVWALG 194 >ref|XP_006488879.1| PREDICTED: importin subunit alpha-1-like [Citrus sinensis] Length = 532 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAVWALG 185 >ref|XP_007144986.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris] gi|561018176|gb|ESW16980.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris] Length = 532 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAVWALG 185 >ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine max] gi|571570393|ref|XP_006606551.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine max] Length = 532 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAVWALG 185 >ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 532 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAVWALG 185 >ref|XP_006355403.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Solanum tuberosum] gi|565377899|ref|XP_006355404.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Solanum tuberosum] Length = 529 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+T+VVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAVWALG 185 >ref|XP_007154341.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris] gi|561027695|gb|ESW26335.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris] Length = 529 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 135 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 184 >ref|XP_007138966.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris] gi|561012053|gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris] Length = 529 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 135 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 184 >ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum] Length = 531 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 185 >ref|XP_007205032.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica] gi|462400674|gb|EMJ06231.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica] Length = 530 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 134 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 183 >ref|XP_004228994.1| PREDICTED: importin subunit alpha-1a-like [Solanum lycopersicum] Length = 530 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+T+VVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 137 FEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAVWALG 186 >ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Length = 530 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 135 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 184 >ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine max] gi|571518596|ref|XP_006597715.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine max] Length = 531 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 185 >ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine max] gi|571476251|ref|XP_006586905.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine max] gi|571476254|ref|XP_006586906.1| PREDICTED: importin subunit alpha-1-like isoform X3 [Glycine max] Length = 531 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 185 >ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatula] gi|355483860|gb|AES65063.1| Importin subunit alpha-1 [Medicago truncatula] Length = 561 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+TKVVIDHG V +FVKLL+SPS+DV EQ +G Sbjct: 135 FEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALG 184 >ref|XP_002512485.1| importin alpha, putative [Ricinus communis] gi|223548446|gb|EEF49937.1| importin alpha, putative [Ricinus communis] Length = 531 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+T+VVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 134 FEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAVWALG 183 >ref|XP_002519178.1| importin alpha, putative [Ricinus communis] gi|223541493|gb|EEF43042.1| importin alpha, putative [Ricinus communis] Length = 488 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 347 FKVAWALTNIAFGTYEHTKVVIDHGVVQVFVKLLASPSNDVHEQVNCKVG 496 F+ AWALTNIA GT E+T+VVIDHG V +FVKLLASPS+DV EQ +G Sbjct: 136 FEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAVWALG 185