BLASTX nr result
ID: Paeonia22_contig00013479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00013479 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006576510.1| polyprotein p1 [Grapevine Anatolian ringspot... 70 2e-10 ref|NP_619705.1| polyprotein [Grapevine chrome mosaic virus] gi|... 62 8e-08 ref|NP_734047.1| protease cofactor [Grapevine chrome mosaic virus] 62 8e-08 >ref|YP_006576510.1| polyprotein p1 [Grapevine Anatolian ringspot virus] gi|400131550|emb|CCG47847.1| polyprotein p1 [Grapevine Anatolian ringspot virus] Length = 2243 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +1 Query: 43 VTLPYCKYNNSLNKYLFYNSNISVNLDLFSYYFNYDKRLSEAKKFF 180 +TLPYCKYNNSLNKYLFY SN+ ++LD FS+Y+NY+++L K FF Sbjct: 6 MTLPYCKYNNSLNKYLFY-SNLDIDLDNFSFYYNYNRKLKSLKDFF 50 >ref|NP_619705.1| polyprotein [Grapevine chrome mosaic virus] gi|130391|sp|P13025.1|POL1_GCMV RecName: Full=RNA1 polyprotein; AltName: Full=P1; Contains: RecName: Full=P1A protein; Short=1A; AltName: Full=Protease cofactor; Contains: RecName: Full=Putative ATP-dependent helicase; AltName: Full=1B; AltName: Full=Membrane-binding protein; AltName: Full=NTP-binding protein; Short=NTB; Contains: RecName: Full=Viral genome-linked protein; AltName: Full=1C-VPg; Contains: RecName: Full=Picornain 3C-like protease; Short=3C-like protease; AltName: Full=1D-PRO; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=1E-POL gi|59346|emb|CAA33405.1| unnamed protein product [Grapevine chrome mosaic virus] Length = 2252 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 43 VTLPYCKYNNSLNKYLFYNSNISVNLDLFSYYFNYDKRLSEAKKFFLSV 189 + LPY KYN SLNKYLFYNSN+ ++LD F++Y Y+ LS K+ FL + Sbjct: 6 IILPYAKYNYSLNKYLFYNSNLDIDLDSFNFYKKYNNTLSLLKRKFLDL 54 >ref|NP_734047.1| protease cofactor [Grapevine chrome mosaic virus] Length = 571 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +1 Query: 43 VTLPYCKYNNSLNKYLFYNSNISVNLDLFSYYFNYDKRLSEAKKFFLSV 189 + LPY KYN SLNKYLFYNSN+ ++LD F++Y Y+ LS K+ FL + Sbjct: 6 IILPYAKYNYSLNKYLFYNSNLDIDLDSFNFYKKYNNTLSLLKRKFLDL 54