BLASTX nr result
ID: Paeonia22_contig00013294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00013294 (750 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004830998.1| phosphatidylinositol 3- and 4-kinase domain-... 59 1e-06 >ref|XP_004830998.1| phosphatidylinositol 3- and 4-kinase domain-containing protein [Babesia equi] gi|429329573|gb|AFZ81332.1| phosphatidylinositol 3- and 4-kinase domain-containing protein [Babesia equi] Length = 561 Score = 59.3 bits (142), Expect = 1e-06 Identities = 39/90 (43%), Positives = 52/90 (57%), Gaps = 8/90 (8%) Frame = +1 Query: 442 PKL-INEERSTYYMFNKKEKKIAIFKPLDEETGSHLNP--WDNDVDQ-----GCVLGGGG 597 PKL ++ TY MFNK K AIFKP+DEE + NP ++ ++Q G + G G Sbjct: 90 PKLTMDGTGGTYQMFNKLRKCCAIFKPIDEEAFTPYNPRGYEGKMNQQGFRTGVLSGEGA 149 Query: 598 NREVVAYHFDKAAGNCTVGVSLTIMVDCSH 687 +REV AY D+A G GV +T MV+ SH Sbjct: 150 SREVAAYLLDEAYGG-LCGVPITTMVEASH 178