BLASTX nr result
ID: Paeonia22_contig00013253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00013253 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]... 48 8e-06 >ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis] gi|223531936|gb|EEF33750.1| cytochrome P450, putative [Ricinus communis] Length = 512 Score = 48.1 bits (113), Expect(2) = 8e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 253 NPK*YENTRD*LPYLQAVVRETLRLHPAIPLLL 155 N K E+ D LPYLQAVV+ETLRLHPAIPLLL Sbjct: 348 NNKVEESDIDKLPYLQAVVKETLRLHPAIPLLL 380 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -2 Query: 303 LFFA*SETTNSTIEWFVTQ 247 +FFA SETT++T+EW + + Sbjct: 308 MFFAGSETTSTTMEWAMAE 326