BLASTX nr result
ID: Paeonia22_contig00013158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00013158 (1152 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB88154.1| hypothetical protein L484_005579 [Morus notabilis] 59 5e-06 ref|XP_004302177.1| PREDICTED: putative RNA-binding protein Luc7... 58 7e-06 >gb|EXB88154.1| hypothetical protein L484_005579 [Morus notabilis] Length = 473 Score = 58.5 bits (140), Expect = 5e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 1151 ERRLADHFGGKLHLGYMQIREKLAELQVQ*FIC 1053 +RRLADHFGGKLHLGYMQIREKL ELQ + + C Sbjct: 299 DRRLADHFGGKLHLGYMQIREKLGELQTEIWYC 331 >ref|XP_004302177.1| PREDICTED: putative RNA-binding protein Luc7-like 1-like [Fragaria vesca subsp. vesca] Length = 411 Score = 58.2 bits (139), Expect = 7e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 1151 ERRLADHFGGKLHLGYMQIREKLAELQVQ 1065 +RRLADHFGGKLHLGYMQIREKLAELQ + Sbjct: 285 DRRLADHFGGKLHLGYMQIREKLAELQAE 313