BLASTX nr result
ID: Paeonia22_contig00013062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00013062 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202742.1| hypothetical protein PRUPE_ppa013195mg [Prun... 115 8e-24 ref|XP_004288030.1| PREDICTED: protein RALF-like 34-like [Fragar... 112 7e-23 ref|XP_002282668.1| PREDICTED: uncharacterized protein LOC100264... 111 9e-23 ref|XP_007156795.1| hypothetical protein PHAVU_002G018200g [Phas... 109 4e-22 ref|XP_007047279.1| Ralf-like 34, putative [Theobroma cacao] gi|... 108 6e-22 ref|XP_003539363.1| PREDICTED: uncharacterized LOC100305899 [Gly... 108 6e-22 ref|XP_007017197.1| Ralf-like 34, putative [Theobroma cacao] gi|... 107 2e-21 ref|XP_004169047.1| PREDICTED: protein RALF-like 34-like [Cucumi... 107 2e-21 ref|XP_004148071.1| PREDICTED: protein RALF-like 34-like [Cucumi... 107 2e-21 ref|XP_002523599.1| RALFL33, putative [Ricinus communis] gi|2235... 107 2e-21 gb|EXC63654.1| hypothetical protein L484_000058 [Morus notabilis] 106 4e-21 gb|EXB54394.1| hypothetical protein L484_011056 [Morus notabilis] 106 4e-21 ref|NP_201508.1| protein ralf-like 34 [Arabidopsis thaliana] gi|... 106 4e-21 ref|XP_002866719.1| hypothetical protein ARALYDRAFT_920006 [Arab... 106 4e-21 gb|AFK39603.1| unknown [Lotus japonicus] 105 5e-21 ref|XP_006466596.1| PREDICTED: protein RALF-like 34-like [Citrus... 105 6e-21 ref|XP_006425908.1| hypothetical protein CICLE_v10026759mg [Citr... 105 6e-21 ref|XP_004511922.1| PREDICTED: protein RALF-like 34-like [Cicer ... 105 6e-21 ref|XP_006281307.1| hypothetical protein CARUB_v10027357mg [Caps... 105 6e-21 gb|EYU44408.1| hypothetical protein MIMGU_mgv1a016135mg [Mimulus... 104 1e-20 >ref|XP_007202742.1| hypothetical protein PRUPE_ppa013195mg [Prunus persica] gi|462398273|gb|EMJ03941.1| hypothetical protein PRUPE_ppa013195mg [Prunus persica] Length = 135 Score = 115 bits (287), Expect = 8e-24 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R M+YYISYGALSANRIPCPPR G SYYTHNCFKARGPVRPYTRGCSRI RCRR Sbjct: 79 LFWRRMKYYISYGALSANRIPCPPRSGRSYYTHNCFKARGPVRPYTRGCSRIARCRR 135 >ref|XP_004288030.1| PREDICTED: protein RALF-like 34-like [Fragaria vesca subsp. vesca] Length = 134 Score = 112 bits (279), Expect = 7e-23 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R MRYYISYGALSANRIPCPPR G SYYT+NCFKARGPV PY+RGCSRITRCRR Sbjct: 78 LFWRRMRYYISYGALSANRIPCPPRSGRSYYTNNCFKARGPVHPYSRGCSRITRCRR 134 >ref|XP_002282668.1| PREDICTED: uncharacterized protein LOC100264539 [Vitis vinifera] gi|296082412|emb|CBI21417.3| unnamed protein product [Vitis vinifera] Length = 125 Score = 111 bits (278), Expect = 9e-23 Identities = 49/57 (85%), Positives = 51/57 (89%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 +F MRYYISYGALSANRIPCPPR G SYYTHNCF+ARGPVRPYTRGCS ITRCRR Sbjct: 69 MFWHRMRYYISYGALSANRIPCPPRSGRSYYTHNCFQARGPVRPYTRGCSTITRCRR 125 >ref|XP_007156795.1| hypothetical protein PHAVU_002G018200g [Phaseolus vulgaris] gi|561030210|gb|ESW28789.1| hypothetical protein PHAVU_002G018200g [Phaseolus vulgaris] Length = 127 Score = 109 bits (272), Expect = 4e-22 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R M+YYISYGALSANRIPCPPR G SYYTHNC+KARGPV PY+RGCS ITRCRR Sbjct: 71 LFWRRMKYYISYGALSANRIPCPPRSGRSYYTHNCYKARGPVHPYSRGCSVITRCRR 127 >ref|XP_007047279.1| Ralf-like 34, putative [Theobroma cacao] gi|508699540|gb|EOX91436.1| Ralf-like 34, putative [Theobroma cacao] Length = 132 Score = 108 bits (271), Expect = 6e-22 Identities = 49/57 (85%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF + MRYYISYGALSANRIPCPPR G SYYT NCFKA GPV PYTRGCSRITRCRR Sbjct: 76 LFWKRMRYYISYGALSANRIPCPPRSGRSYYTLNCFKAHGPVHPYTRGCSRITRCRR 132 >ref|XP_003539363.1| PREDICTED: uncharacterized LOC100305899 [Glycine max] Length = 121 Score = 108 bits (271), Expect = 6e-22 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R M+YYISYGALSANRIPCPPR G SYYTHNC++ARGPV PY+RGCS ITRCRR Sbjct: 65 LFWRRMKYYISYGALSANRIPCPPRSGRSYYTHNCYRARGPVHPYSRGCSAITRCRR 121 >ref|XP_007017197.1| Ralf-like 34, putative [Theobroma cacao] gi|508722525|gb|EOY14422.1| Ralf-like 34, putative [Theobroma cacao] Length = 119 Score = 107 bits (267), Expect = 2e-21 Identities = 47/57 (82%), Positives = 49/57 (85%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 L+ + M YYISYGALSANRIPCPPR G SYYTHNCFKAR P PYTRGCSRITRCRR Sbjct: 63 LYWKRMHYYISYGALSANRIPCPPRSGRSYYTHNCFKAREPANPYTRGCSRITRCRR 119 >ref|XP_004169047.1| PREDICTED: protein RALF-like 34-like [Cucumis sativus] Length = 125 Score = 107 bits (267), Expect = 2e-21 Identities = 47/57 (82%), Positives = 49/57 (85%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R + YYISYGALSANRIPCPPR G YYTHNC+KARGPV PYTRGCS ITRCRR Sbjct: 69 LFWRRVHYYISYGALSANRIPCPPRSGRPYYTHNCYKARGPVNPYTRGCSAITRCRR 125 >ref|XP_004148071.1| PREDICTED: protein RALF-like 34-like [Cucumis sativus] Length = 125 Score = 107 bits (267), Expect = 2e-21 Identities = 47/57 (82%), Positives = 49/57 (85%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R + YYISYGALSANRIPCPPR G YYTHNC+KARGPV PYTRGCS ITRCRR Sbjct: 69 LFWRRVHYYISYGALSANRIPCPPRSGRPYYTHNCYKARGPVNPYTRGCSAITRCRR 125 >ref|XP_002523599.1| RALFL33, putative [Ricinus communis] gi|223537161|gb|EEF38794.1| RALFL33, putative [Ricinus communis] Length = 128 Score = 107 bits (266), Expect = 2e-21 Identities = 47/57 (82%), Positives = 49/57 (85%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R + YYISYGALSANRIPCPPR G SYYTHNCF +R PV PYTRGCSRITRCRR Sbjct: 72 LFWRRVHYYISYGALSANRIPCPPRSGRSYYTHNCFHSRAPVNPYTRGCSRITRCRR 128 >gb|EXC63654.1| hypothetical protein L484_000058 [Morus notabilis] Length = 82 Score = 106 bits (264), Expect = 4e-21 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +2 Query: 98 YYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 YYISYGALSANRIPCPPR G SYYTHNCFKARGPV PYTRGCSRI+RCRR Sbjct: 33 YYISYGALSANRIPCPPRSGRSYYTHNCFKARGPVHPYTRGCSRISRCRR 82 >gb|EXB54394.1| hypothetical protein L484_011056 [Morus notabilis] Length = 128 Score = 106 bits (264), Expect = 4e-21 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +2 Query: 98 YYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 YYISYGALSANRIPCPPR G SYYTHNCFKARGPV PYTRGCSRI+RCRR Sbjct: 79 YYISYGALSANRIPCPPRSGRSYYTHNCFKARGPVHPYTRGCSRISRCRR 128 >ref|NP_201508.1| protein ralf-like 34 [Arabidopsis thaliana] gi|75170583|sp|Q9FHA6.1|RLF34_ARATH RecName: Full=Protein RALF-like 34; Flags: Precursor gi|13877899|gb|AAK44027.1|AF370212_1 unknown protein [Arabidopsis thaliana] gi|10177594|dbj|BAB10941.1| unnamed protein product [Arabidopsis thaliana] gi|22136922|gb|AAM91805.1| unknown protein [Arabidopsis thaliana] gi|332010914|gb|AED98297.1| protein ralf-like 34 [Arabidopsis thaliana] Length = 129 Score = 106 bits (264), Expect = 4e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 L+ R +YYISYGALSANR+PCPPR G SYYTHNCF+ARGPV PY+RGCS ITRCRR Sbjct: 73 LYWRRTKYYISYGALSANRVPCPPRSGRSYYTHNCFRARGPVHPYSRGCSSITRCRR 129 >ref|XP_002866719.1| hypothetical protein ARALYDRAFT_920006 [Arabidopsis lyrata subsp. lyrata] gi|297312554|gb|EFH42978.1| hypothetical protein ARALYDRAFT_920006 [Arabidopsis lyrata subsp. lyrata] Length = 128 Score = 106 bits (264), Expect = 4e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 L+ R +YYISYGALSANR+PCPPR G SYYTHNCF+ARGPV PY+RGCS ITRCRR Sbjct: 72 LYWRRTKYYISYGALSANRVPCPPRSGRSYYTHNCFRARGPVHPYSRGCSSITRCRR 128 >gb|AFK39603.1| unknown [Lotus japonicus] Length = 174 Score = 105 bits (263), Expect = 5e-21 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF R ++YYISYGALSANRIPCPPR G SYYTH+C+KARGPV PY+RGCS ITRCRR Sbjct: 71 LFWRRVKYYISYGALSANRIPCPPRSGRSYYTHDCYKARGPVHPYSRGCSIITRCRR 127 >ref|XP_006466596.1| PREDICTED: protein RALF-like 34-like [Citrus sinensis] Length = 130 Score = 105 bits (262), Expect = 6e-21 Identities = 47/57 (82%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF + M+YYISYGALSANRIPCPPR G SYYT NC+KARGPV PYTRGCS ITRCRR Sbjct: 74 LFWQRMKYYISYGALSANRIPCPPRSGRSYYTPNCYKARGPVHPYTRGCSVITRCRR 130 >ref|XP_006425908.1| hypothetical protein CICLE_v10026759mg [Citrus clementina] gi|557527898|gb|ESR39148.1| hypothetical protein CICLE_v10026759mg [Citrus clementina] Length = 130 Score = 105 bits (262), Expect = 6e-21 Identities = 47/57 (82%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF + M+YYISYGALSANRIPCPPR G SYYT NC+KARGPV PYTRGCS ITRCRR Sbjct: 74 LFWQRMKYYISYGALSANRIPCPPRSGRSYYTPNCYKARGPVHPYTRGCSVITRCRR 130 >ref|XP_004511922.1| PREDICTED: protein RALF-like 34-like [Cicer arietinum] Length = 121 Score = 105 bits (262), Expect = 6e-21 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 LF ++YYISYGALSANRIPCPPR G SYYTHNC+KARGPV PY+RGCS ITRCRR Sbjct: 65 LFWSRVKYYISYGALSANRIPCPPRSGRSYYTHNCYKARGPVHPYSRGCSVITRCRR 121 >ref|XP_006281307.1| hypothetical protein CARUB_v10027357mg [Capsella rubella] gi|482550011|gb|EOA14205.1| hypothetical protein CARUB_v10027357mg [Capsella rubella] Length = 132 Score = 105 bits (262), Expect = 6e-21 Identities = 45/57 (78%), Positives = 49/57 (85%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 L+ R +YYISYGALSANR+PCPPR G SYYTHNCF+ARGPV PY RGCS ITRCRR Sbjct: 75 LYWRRRKYYISYGALSANRVPCPPRSGRSYYTHNCFRARGPVHPYRRGCSSITRCRR 131 >gb|EYU44408.1| hypothetical protein MIMGU_mgv1a016135mg [Mimulus guttatus] Length = 133 Score = 104 bits (260), Expect = 1e-20 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 77 LFGRAMRYYISYGALSANRIPCPPRLGSSYYTHNCFKARGPVRPYTRGCSRITRCRR 247 L+ RAM YYISYGALSA+RIPCPPR G SYYTHNC++ARGP PYTRGCS IT+CRR Sbjct: 77 LWKRAMHYYISYGALSADRIPCPPRSGRSYYTHNCYRARGPAHPYTRGCSAITQCRR 133