BLASTX nr result
ID: Paeonia22_contig00012898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00012898 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029309.1| Cytidine/deoxycytidylate deaminase family pr... 68 1e-09 ref|XP_007029308.1| Cytidine/deoxycytidylate deaminase family pr... 68 1e-09 ref|XP_002514838.1| riboflavin-specific deaminase, putative [Ric... 64 3e-08 ref|XP_003631864.1| PREDICTED: riboflavin biosynthesis protein R... 60 4e-07 ref|XP_004304817.1| PREDICTED: riboflavin biosynthesis protein R... 59 5e-07 ref|XP_002875837.1| predicted protein [Arabidopsis lyrata subsp.... 58 1e-06 ref|NP_001190026.1| putative pyrimidine reductase [Arabidopsis ... 58 2e-06 ref|NP_190323.1| putative pyrimidine reductase [Arabidopsis tha... 58 2e-06 ref|XP_006428604.1| hypothetical protein CICLE_v10011346mg [Citr... 57 3e-06 ref|XP_006428603.1| hypothetical protein CICLE_v10011346mg [Citr... 57 3e-06 ref|XP_006428602.1| hypothetical protein CICLE_v10011346mg [Citr... 57 3e-06 ref|XP_006428600.1| hypothetical protein CICLE_v10011346mg [Citr... 57 3e-06 gb|EXC29949.1| Riboflavin biosynthesis protein RibD [Morus notab... 56 5e-06 ref|XP_007139723.1| hypothetical protein PHAVU_008G053900g [Phas... 55 8e-06 ref|XP_007139722.1| hypothetical protein PHAVU_008G053900g [Phas... 55 8e-06 >ref|XP_007029309.1| Cytidine/deoxycytidylate deaminase family protein isoform 2 [Theobroma cacao] gi|508717914|gb|EOY09811.1| Cytidine/deoxycytidylate deaminase family protein isoform 2 [Theobroma cacao] Length = 438 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GR+GEGLNYLGRLLMQLRSEFLGESP + ESTCLAL Sbjct: 403 GRDGEGLNYLGRLLMQLRSEFLGESPAASESTCLAL 438 >ref|XP_007029308.1| Cytidine/deoxycytidylate deaminase family protein isoform 1 [Theobroma cacao] gi|508717913|gb|EOY09810.1| Cytidine/deoxycytidylate deaminase family protein isoform 1 [Theobroma cacao] Length = 630 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GR+GEGLNYLGRLLMQLRSEFLGESP + ESTCLAL Sbjct: 595 GRDGEGLNYLGRLLMQLRSEFLGESPAASESTCLAL 630 >ref|XP_002514838.1| riboflavin-specific deaminase, putative [Ricinus communis] gi|223545889|gb|EEF47392.1| riboflavin-specific deaminase, putative [Ricinus communis] Length = 600 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GREGEGLNYLGRLLM+LRS+FLGES S ESTC+AL Sbjct: 565 GREGEGLNYLGRLLMRLRSKFLGESSTSSESTCIAL 600 >ref|XP_003631864.1| PREDICTED: riboflavin biosynthesis protein RibD-like [Vitis vinifera] gi|297735254|emb|CBI17616.3| unnamed protein product [Vitis vinifera] Length = 586 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GR+GEGLNYLGRLLMQLRSEFLGES S ES+ LAL Sbjct: 551 GRDGEGLNYLGRLLMQLRSEFLGESLTSSESSFLAL 586 >ref|XP_004304817.1| PREDICTED: riboflavin biosynthesis protein RibD-like [Fragaria vesca subsp. vesca] Length = 590 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GR+GEGLNYLGRLLMQLRSEFLGES ES+CL + Sbjct: 555 GRDGEGLNYLGRLLMQLRSEFLGESHTLSESSCLGV 590 >ref|XP_002875837.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321675|gb|EFH52096.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 579 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLA 106 GREGEGLNYLGRLLMQLRSE+LGES +S E+T A Sbjct: 545 GREGEGLNYLGRLLMQLRSEYLGESSVSAENTSSA 579 >ref|NP_001190026.1| putative pyrimidine reductase [Arabidopsis thaliana] gi|332644755|gb|AEE78276.1| putative pyrimidine reductase [Arabidopsis thaliana] Length = 596 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLA 106 GREGEGLNYLGRLLMQLRSE+LGES +S E T A Sbjct: 562 GREGEGLNYLGRLLMQLRSEYLGESSVSAEKTSSA 596 >ref|NP_190323.1| putative pyrimidine reductase [Arabidopsis thaliana] gi|75207753|sp|Q9STY4.1|RIBR_ARATH RecName: Full=Riboflavin biosynthesis protein PYRR, chloroplastic; Includes: RecName: Full=Inactive diaminohydroxyphosphoribosylaminopyrimidine deaminase; Short=DRAP deaminase; AltName: Full=Riboflavin-specific deaminase; Includes: RecName: Full=5-amino-6-(5-phosphoribosylamino)uracil reductase; AltName: Full=HTP reductase; Flags: Precursor gi|5541706|emb|CAB51211.1| putative protein [Arabidopsis thaliana] gi|332644754|gb|AEE78275.1| putative pyrimidine reductase [Arabidopsis thaliana] Length = 599 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLA 106 GREGEGLNYLGRLLMQLRSE+LGES +S E T A Sbjct: 565 GREGEGLNYLGRLLMQLRSEYLGESSVSAEKTSSA 599 >ref|XP_006428604.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|557530661|gb|ESR41844.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] Length = 589 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPIS 85 GREGEGLNYLGRLLMQLRSEFLGESP S Sbjct: 561 GREGEGLNYLGRLLMQLRSEFLGESPTS 588 >ref|XP_006428603.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|568853594|ref|XP_006480436.1| PREDICTED: riboflavin biosynthesis protein PYRR, chloroplastic-like [Citrus sinensis] gi|557530660|gb|ESR41843.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] Length = 577 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPIS 85 GREGEGLNYLGRLLMQLRSEFLGESP S Sbjct: 549 GREGEGLNYLGRLLMQLRSEFLGESPTS 576 >ref|XP_006428602.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|557530659|gb|ESR41842.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] Length = 562 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPIS 85 GREGEGLNYLGRLLMQLRSEFLGESP S Sbjct: 534 GREGEGLNYLGRLLMQLRSEFLGESPTS 561 >ref|XP_006428600.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|567872023|ref|XP_006428601.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|567872031|ref|XP_006428605.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|557530657|gb|ESR41840.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|557530658|gb|ESR41841.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] gi|557530662|gb|ESR41845.1| hypothetical protein CICLE_v10011346mg [Citrus clementina] Length = 395 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPIS 85 GREGEGLNYLGRLLMQLRSEFLGESP S Sbjct: 367 GREGEGLNYLGRLLMQLRSEFLGESPTS 394 >gb|EXC29949.1| Riboflavin biosynthesis protein RibD [Morus notabilis] Length = 604 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GR+GEGLNYLGRLLMQLRSEFLGES S +S+ + + Sbjct: 569 GRDGEGLNYLGRLLMQLRSEFLGESQASSQSSIITV 604 >ref|XP_007139723.1| hypothetical protein PHAVU_008G053900g [Phaseolus vulgaris] gi|561012856|gb|ESW11717.1| hypothetical protein PHAVU_008G053900g [Phaseolus vulgaris] Length = 494 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GREGEGLNYLGRLLM+LRSEFLGES S E+ L + Sbjct: 459 GREGEGLNYLGRLLMKLRSEFLGESSSSSEAPSLTV 494 >ref|XP_007139722.1| hypothetical protein PHAVU_008G053900g [Phaseolus vulgaris] gi|561012855|gb|ESW11716.1| hypothetical protein PHAVU_008G053900g [Phaseolus vulgaris] Length = 467 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 2 GREGEGLNYLGRLLMQLRSEFLGESPISDESTCLAL 109 GREGEGLNYLGRLLM+LRSEFLGES S E+ L + Sbjct: 432 GREGEGLNYLGRLLMKLRSEFLGESSSSSEAPSLTV 467