BLASTX nr result
ID: Paeonia22_contig00012657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00012657 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304233.2| hypothetical protein POPTR_0003s06730g [Popu... 57 3e-06 ref|XP_002506084.1| predicted protein [Micromonas sp. RCC299] gi... 55 8e-06 >ref|XP_002304233.2| hypothetical protein POPTR_0003s06730g [Populus trichocarpa] gi|550342574|gb|EEE79212.2| hypothetical protein POPTR_0003s06730g [Populus trichocarpa] Length = 515 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/79 (36%), Positives = 40/79 (50%) Frame = +1 Query: 169 SKFQQGGRKIETVCKYWVQGRCRLGEICRFQHPRIAGDEHKSGGRGLKPAAAIAIDQVCK 348 S +QGG + +C+Y+ QGRC G C+F H E + G Q+C+ Sbjct: 420 SPHRQGGDQQIQLCRYFAQGRCHYGHNCKFVH------ESREG-------------QLCR 460 Query: 349 YWVQGRCCLGENCKFQHPS 405 Y+ QGRC G +CKF H S Sbjct: 461 YFAQGRCYYGHDCKFVHES 479 >ref|XP_002506084.1| predicted protein [Micromonas sp. RCC299] gi|226521355|gb|ACO67342.1| predicted protein [Micromonas sp. RCC299] Length = 567 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 6/78 (7%) Frame = +1 Query: 184 GGRKIETVCKYWVQGRCRLGEICRFQHPRIAGDEHKSGGRG------LKPAAAIAIDQVC 345 GGR+ C+YW G+CR G+ C F H AG G + P A C Sbjct: 354 GGRQGTRPCRYWQLGKCRRGDACDFVHAGDAGGNRAGASTGAETCPTISPTNAATNATPC 413 Query: 346 KYWVQGRCCLGENCKFQH 399 +++++GRC G C F H Sbjct: 414 RFFLRGRCKSGRRCAFAH 431