BLASTX nr result
ID: Paeonia22_contig00012619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00012619 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43811.1| hypothetical protein MIMGU_mgv1a011652mg [Mimulus... 67 3e-09 ref|XP_004963249.1| PREDICTED: GATA transcription factor 2-like ... 67 3e-09 ref|XP_006664221.1| PREDICTED: GATA transcription factor 3-like ... 66 4e-09 ref|XP_006340920.1| PREDICTED: GATA transcription factor 1-like ... 66 4e-09 gb|EPS68410.1| hypothetical protein M569_06360, partial [Genlise... 66 4e-09 ref|XP_004247814.1| PREDICTED: GATA transcription factor 1-like ... 66 4e-09 dbj|BAC98492.1| AG-motif binding protein-2 [Nicotiana tabacum] 66 4e-09 ref|XP_003579113.1| PREDICTED: GATA transcription factor 2-like ... 66 4e-09 ref|XP_002442575.1| hypothetical protein SORBIDRAFT_08g022276 [S... 66 4e-09 gb|EMT25721.1| GATA transcription factor 4 [Aegilops tauschii] 66 6e-09 gb|EMS54583.1| GATA transcription factor 4 [Triticum urartu] 66 6e-09 gb|EYU32614.1| hypothetical protein MIMGU_mgv1a023497mg, partial... 65 8e-09 ref|XP_006343049.1| PREDICTED: GATA transcription factor 12-like... 65 8e-09 ref|XP_006445338.1| hypothetical protein CICLE_v10021733mg [Citr... 65 8e-09 gb|EPS61914.1| hypothetical protein M569_12879, partial [Genlise... 65 8e-09 ref|XP_007034503.1| GATA transcription factor 1, putative [Theob... 65 8e-09 ref|XP_007226931.1| hypothetical protein PRUPE_ppa015753mg [Prun... 65 8e-09 ref|XP_004235652.1| PREDICTED: GATA transcription factor 12-like... 65 8e-09 gb|AAM65139.1| GATA transcription factor 1 (AtGATA-1) [Arabidops... 65 8e-09 ref|NP_191612.1| GATA transcription factor 4 [Arabidopsis thalia... 65 8e-09 >gb|EYU43811.1| hypothetical protein MIMGU_mgv1a011652mg [Mimulus guttatus] Length = 275 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 RTP WR GP+GPKTLCNACG+RY G+L+PE +PAN Sbjct: 204 RTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYRPAN 239 >ref|XP_004963249.1| PREDICTED: GATA transcription factor 2-like [Setaria italica] Length = 312 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 250 KTPQWRSGPLGPKTLCNACGVRYKSGRLLPEYRPAN 285 >ref|XP_006664221.1| PREDICTED: GATA transcription factor 3-like [Oryza brachyantha] Length = 307 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 244 KTPQWRTGPLGPKTLCNACGVRYKSGRLLPEYRPAN 279 >ref|XP_006340920.1| PREDICTED: GATA transcription factor 1-like [Solanum tuberosum] Length = 285 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 202 KTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAN 237 >gb|EPS68410.1| hypothetical protein M569_06360, partial [Genlisea aurea] Length = 151 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR+GP+GPKTLCNACG+RY G+L+PE +PAN Sbjct: 93 KTPQWREGPMGPKTLCNACGVRYKSGRLLPEYRPAN 128 >ref|XP_004247814.1| PREDICTED: GATA transcription factor 1-like [Solanum lycopersicum] Length = 285 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 202 KTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAN 237 >dbj|BAC98492.1| AG-motif binding protein-2 [Nicotiana tabacum] Length = 289 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 214 KTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAN 249 >ref|XP_003579113.1| PREDICTED: GATA transcription factor 2-like [Brachypodium distachyon] Length = 321 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 258 KTPQWRTGPLGPKTLCNACGVRYKSGRLLPEYRPAN 293 >ref|XP_002442575.1| hypothetical protein SORBIDRAFT_08g022276 [Sorghum bicolor] gi|241943268|gb|EES16413.1| hypothetical protein SORBIDRAFT_08g022276 [Sorghum bicolor] Length = 306 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 240 KTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAN 275 >gb|EMT25721.1| GATA transcription factor 4 [Aegilops tauschii] Length = 423 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 5 TPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 353 TPQWRSGPLGPKTLCNACGVRYKSGRLLPEYRPAN 387 >gb|EMS54583.1| GATA transcription factor 4 [Triticum urartu] Length = 372 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 5 TPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 TP WR GPLGPKTLCNACG+RY G+L+PE +PAN Sbjct: 302 TPQWRSGPLGPKTLCNACGVRYKSGRLLPEYRPAN 336 >gb|EYU32614.1| hypothetical protein MIMGU_mgv1a023497mg, partial [Mimulus guttatus] Length = 235 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GP+GPKTLCNACG+RY G+L+PE +PAN Sbjct: 157 KTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYRPAN 192 >ref|XP_006343049.1| PREDICTED: GATA transcription factor 12-like [Solanum tuberosum] Length = 351 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+LVPE +PA+ Sbjct: 247 KTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAS 282 >ref|XP_006445338.1| hypothetical protein CICLE_v10021733mg [Citrus clementina] gi|568875525|ref|XP_006490843.1| PREDICTED: GATA transcription factor 2-like [Citrus sinensis] gi|557547600|gb|ESR58578.1| hypothetical protein CICLE_v10021733mg [Citrus clementina] Length = 263 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+LVPE +PA+ Sbjct: 174 KTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAS 209 >gb|EPS61914.1| hypothetical protein M569_12879, partial [Genlisea aurea] Length = 73 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPA 106 +TP WRKGP GPKTLCNACG+RY G+LVPE +PA Sbjct: 14 KTPQWRKGPSGPKTLCNACGVRYKAGRLVPEYRPA 48 >ref|XP_007034503.1| GATA transcription factor 1, putative [Theobroma cacao] gi|508713532|gb|EOY05429.1| GATA transcription factor 1, putative [Theobroma cacao] Length = 243 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+LVPE +PA+ Sbjct: 172 KTPQWRAGPLGPKTLCNACGVRYKSGRLVPEYRPAS 207 >ref|XP_007226931.1| hypothetical protein PRUPE_ppa015753mg [Prunus persica] gi|462423867|gb|EMJ28130.1| hypothetical protein PRUPE_ppa015753mg [Prunus persica] Length = 384 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+LVPE +PA+ Sbjct: 272 KTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAS 307 >ref|XP_004235652.1| PREDICTED: GATA transcription factor 12-like [Solanum lycopersicum] Length = 350 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+LVPE +PA+ Sbjct: 246 KTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAS 281 >gb|AAM65139.1| GATA transcription factor 1 (AtGATA-1) [Arabidopsis thaliana] Length = 268 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GP GPKTLCNACG+RY G+LVPE +PAN Sbjct: 197 KTPQWRAGPAGPKTLCNACGVRYKSGRLVPEYRPAN 232 >ref|NP_191612.1| GATA transcription factor 4 [Arabidopsis thaliana] gi|62900345|sp|O49743.1|GATA4_ARATH RecName: Full=GATA transcription factor 4; Short=AtGATA-4 gi|14190407|gb|AAK55684.1|AF378881_1 AT3g60530/T8B10_190 [Arabidopsis thaliana] gi|2959736|emb|CAA74002.1| homologous to GATA-binding transcription factors [Arabidopsis thaliana] gi|7288001|emb|CAB81839.1| GATA transcription factor 4 [Arabidopsis thaliana] gi|14517395|gb|AAK62588.1| AT3g60530/T8B10_190 [Arabidopsis thaliana] gi|15215891|gb|AAK91489.1| AT3g60530/T8B10_190 [Arabidopsis thaliana] gi|332646554|gb|AEE80075.1| GATA transcription factor 4 [Arabidopsis thaliana] Length = 240 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 RTPDWRKGPLGPKTLCNACGLRYSLGKLVPESKPAN 109 +TP WR GPLGPKTLCNACG+RY G+LVPE +PA+ Sbjct: 167 KTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAS 202