BLASTX nr result
ID: Paeonia22_contig00010778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00010778 (454 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004300971.1| PREDICTED: probable receptor-like protein ki... 56 6e-06 ref|XP_004300967.1| PREDICTED: probable receptor-like protein ki... 56 6e-06 >ref|XP_004300971.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Fragaria vesca subsp. vesca] Length = 643 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = -3 Query: 452 SMSEVINMLEGSIDALQIPPQPFLSSPSRSPANSTT 345 SM +VI MLEGS+++LQIPP+P+LSSP +SPA+S+T Sbjct: 602 SMKQVIEMLEGSVESLQIPPKPYLSSPPKSPAHSST 637 >ref|XP_004300967.1| PREDICTED: probable receptor-like protein kinase At5g39020-like [Fragaria vesca subsp. vesca] Length = 529 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = -3 Query: 452 SMSEVINMLEGSIDALQIPPQPFLSSPSRSPANSTT 345 SM +VI MLEGS+++LQIPP+P+LSSP +SPA+S+T Sbjct: 488 SMKQVIEMLEGSVESLQIPPKPYLSSPPKSPAHSST 523