BLASTX nr result
ID: Paeonia22_contig00009564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00009564 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300559.1| hypothetical protein POPTR_0001s46800g [Popu... 64 2e-08 >ref|XP_002300559.1| hypothetical protein POPTR_0001s46800g [Populus trichocarpa] gi|222847817|gb|EEE85364.1| hypothetical protein POPTR_0001s46800g [Populus trichocarpa] Length = 1716 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/67 (49%), Positives = 40/67 (59%) Frame = +2 Query: 8 DLSNMQRLNLKRKFSAMEPFLMYPQSEHELVKPTCTAMDTSRPLKKRPKCTARFLPASEG 187 +L MQR LKRK A EPF +P +E EL+KP+C AM S PL + CTA + S G Sbjct: 723 NLGTMQRSKLKRKLCAEEPFQTHPNNESELLKPSCLAMTISEPLTQTLNCTAPLVSPSGG 782 Query: 188 NCTKSTS 208 N T S S Sbjct: 783 NYTASIS 789