BLASTX nr result
ID: Paeonia22_contig00009551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00009551 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 125 5e-27 ref|XP_003520990.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 125 8e-27 ref|XP_006437245.1| hypothetical protein CICLE_v10031088mg [Citr... 123 2e-26 ref|XP_006437244.1| hypothetical protein CICLE_v10031088mg [Citr... 123 2e-26 gb|ACU23964.1| unknown [Glycine max] 123 3e-26 gb|AFK35673.1| unknown [Medicago truncatula] 122 4e-26 ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago t... 122 4e-26 ref|XP_002301809.1| hypothetical protein POPTR_0002s24970g [Popu... 122 5e-26 ref|XP_004290160.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 121 1e-25 ref|XP_007200299.1| hypothetical protein PRUPE_ppa003471mg [Prun... 121 1e-25 ref|XP_002268161.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase-... 121 1e-25 ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase ... 121 1e-25 ref|XP_007134161.1| hypothetical protein PHAVU_010G024500g [Phas... 120 2e-25 gb|EXB84490.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus... 120 3e-25 ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 119 6e-25 ref|XP_006840897.1| hypothetical protein AMTR_s00087p00078190 [A... 118 8e-25 ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 118 8e-25 ref|XP_003547780.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 118 8e-25 dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] 118 8e-25 ref|XP_007049646.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao] ... 118 1e-24 >ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] gi|449515125|ref|XP_004164600.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] Length = 553 Score = 125 bits (315), Expect = 5e-27 Identities = 65/86 (75%), Positives = 73/86 (84%) Frame = -3 Query: 269 LYSFNLSLQAALLRLQVTFNVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLE 90 LY+ L +L L+ + NV ALYRRAQAYI+L DLDLAEFDIKKAL+IDPNNRDVKLE Sbjct: 463 LYNEAEKLCTKVLELESS-NVKALYRRAQAYIQLADLDLAEFDIKKALDIDPNNRDVKLE 521 Query: 89 YKTLKEKIKEYNKKQAKFYGNMFSKM 12 YKTLKEK+KEYNKK AKFYGNMF+KM Sbjct: 522 YKTLKEKVKEYNKKDAKFYGNMFAKM 547 >ref|XP_003520990.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Glycine max] Length = 582 Score = 125 bits (313), Expect = 8e-27 Identities = 60/67 (89%), Positives = 65/67 (97%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L DLDLAEFDIKKALEIDPNNRDVKLEYKTLKEK+KEYNKK+AKFY Sbjct: 491 NVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFY 550 Query: 32 GNMFSKM 12 GNMF+K+ Sbjct: 551 GNMFNKL 557 >ref|XP_006437245.1| hypothetical protein CICLE_v10031088mg [Citrus clementina] gi|568862685|ref|XP_006484806.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Citrus sinensis] gi|557539441|gb|ESR50485.1| hypothetical protein CICLE_v10031088mg [Citrus clementina] Length = 572 Score = 123 bits (309), Expect = 2e-26 Identities = 59/67 (88%), Positives = 65/67 (97%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI++ DLDLAEFDIKKALEIDP+NRDVKLEYKTLKEK+KEYNKK+AKFY Sbjct: 481 NVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFY 540 Query: 32 GNMFSKM 12 GNMF+KM Sbjct: 541 GNMFAKM 547 >ref|XP_006437244.1| hypothetical protein CICLE_v10031088mg [Citrus clementina] gi|557539440|gb|ESR50484.1| hypothetical protein CICLE_v10031088mg [Citrus clementina] Length = 559 Score = 123 bits (309), Expect = 2e-26 Identities = 59/67 (88%), Positives = 65/67 (97%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI++ DLDLAEFDIKKALEIDP+NRDVKLEYKTLKEK+KEYNKK+AKFY Sbjct: 481 NVKALYRRAQAYIQMADLDLAEFDIKKALEIDPDNRDVKLEYKTLKEKMKEYNKKEAKFY 540 Query: 32 GNMFSKM 12 GNMF+KM Sbjct: 541 GNMFAKM 547 >gb|ACU23964.1| unknown [Glycine max] Length = 235 Score = 123 bits (308), Expect = 3e-26 Identities = 59/67 (88%), Positives = 65/67 (97%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L DLDLAEFDIKKALEIDPNNRDVKLEYKTLKEK+KEYNKK+AKFY Sbjct: 144 NVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKMKEYNKKEAKFY 203 Query: 32 GNMFSKM 12 G+MF+K+ Sbjct: 204 GDMFNKL 210 >gb|AFK35673.1| unknown [Medicago truncatula] Length = 575 Score = 122 bits (307), Expect = 4e-26 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L D DLAEFDIKKALEIDPNNRDVKLEYKTLKEK+KE NKK AKFY Sbjct: 484 NVKALYRRAQAYIQLADFDLAEFDIKKALEIDPNNRDVKLEYKTLKEKVKEINKKDAKFY 543 Query: 32 GNMFSKM 12 GNMFSKM Sbjct: 544 GNMFSKM 550 >ref|XP_003626943.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355520965|gb|AET01419.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula] Length = 575 Score = 122 bits (307), Expect = 4e-26 Identities = 60/67 (89%), Positives = 62/67 (92%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L D DLAEFDIKKALEIDPNNRDVKLEYKTLKEK+KE NKK AKFY Sbjct: 484 NVKALYRRAQAYIQLADFDLAEFDIKKALEIDPNNRDVKLEYKTLKEKVKEINKKDAKFY 543 Query: 32 GNMFSKM 12 GNMFSKM Sbjct: 544 GNMFSKM 550 >ref|XP_002301809.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa] gi|222843535|gb|EEE81082.1| hypothetical protein POPTR_0002s24970g [Populus trichocarpa] Length = 575 Score = 122 bits (306), Expect = 5e-26 Identities = 59/67 (88%), Positives = 65/67 (97%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L DLDLAEFDIKKALEIDP+NRDVKLE+KTLKEK+KEYNKK+AKFY Sbjct: 484 NVKALYRRAQAYIQLADLDLAEFDIKKALEIDPDNRDVKLEHKTLKEKMKEYNKKEAKFY 543 Query: 32 GNMFSKM 12 GNMF+KM Sbjct: 544 GNMFAKM 550 >ref|XP_004290160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Fragaria vesca subsp. vesca] Length = 565 Score = 121 bits (303), Expect = 1e-25 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L DLDLAE DIKKALEIDPNNRDVKLEYKTLKEK+KE+NKK+AKFY Sbjct: 482 NVKALYRRAQAYIQLADLDLAELDIKKALEIDPNNRDVKLEYKTLKEKMKEFNKKEAKFY 541 Query: 32 GNMFSKM 12 GNMF+K+ Sbjct: 542 GNMFAKL 548 >ref|XP_007200299.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica] gi|462395699|gb|EMJ01498.1| hypothetical protein PRUPE_ppa003471mg [Prunus persica] Length = 572 Score = 121 bits (303), Expect = 1e-25 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L DLDLAE DIKKALEIDPNNRDVKLEYKTLKEK+KE+NKK+AKFY Sbjct: 481 NVKALYRRAQAYIQLADLDLAELDIKKALEIDPNNRDVKLEYKTLKEKMKEFNKKEAKFY 540 Query: 32 GNMFSKM 12 GNMF+K+ Sbjct: 541 GNMFAKL 547 >ref|XP_002268161.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like, partial [Vitis vinifera] gi|296090691|emb|CBI41091.3| unnamed protein product [Vitis vinifera] Length = 342 Score = 121 bits (303), Expect = 1e-25 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI L DLDLAEFDIKKALEIDP+NRDVKLEY+TLKEK+KEYNKK+AKFY Sbjct: 252 NVKALYRRAQAYIHLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFY 311 Query: 32 GNMFSKM 12 GNMF++M Sbjct: 312 GNMFARM 318 >ref|XP_002263566.2| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera] gi|296085741|emb|CBI29552.3| unnamed protein product [Vitis vinifera] Length = 571 Score = 121 bits (303), Expect = 1e-25 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI L DLDLAEFDIKKALEIDP+NRDVKLEY+TLKEK+KEYNKK+AKFY Sbjct: 481 NVKALYRRAQAYIHLADLDLAEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFY 540 Query: 32 GNMFSKM 12 GNMF++M Sbjct: 541 GNMFARM 547 >ref|XP_007134161.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris] gi|561007206|gb|ESW06155.1| hypothetical protein PHAVU_010G024500g [Phaseolus vulgaris] Length = 574 Score = 120 bits (301), Expect = 2e-25 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -3 Query: 236 LLRLQVTFNVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEY 57 +L L+ T NV ALYRRAQAYI+L DLDLAE DIKKALE+DP+NR+VKLEYKTLKEK+KEY Sbjct: 476 VLELEST-NVKALYRRAQAYIQLADLDLAEIDIKKALELDPDNREVKLEYKTLKEKMKEY 534 Query: 56 NKKQAKFYGNMFSKM 12 NKKQAKFYGNMF+K+ Sbjct: 535 NKKQAKFYGNMFNKL 549 >gb|EXB84490.1| Peptidyl-prolyl cis-trans isomerase FKBP62 [Morus notabilis] Length = 547 Score = 120 bits (300), Expect = 3e-25 Identities = 58/67 (86%), Positives = 63/67 (94%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI+L DLDLAEFDIKKALEIDPNN +VKLEYKTLKEK++EYNKK AKFY Sbjct: 463 NVKALYRRAQAYIQLADLDLAEFDIKKALEIDPNNMNVKLEYKTLKEKMREYNKKDAKFY 522 Query: 32 GNMFSKM 12 GNMF+KM Sbjct: 523 GNMFAKM 529 >ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum lycopersicum] Length = 557 Score = 119 bits (297), Expect = 6e-25 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAY+ + DLDLAEFDIKKALEIDPNNRDVKLEYK LKEK+KE+NKK AKFY Sbjct: 483 NVKALYRRAQAYMNMADLDLAEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFY 542 Query: 32 GNMFSKM 12 GNMF+K+ Sbjct: 543 GNMFAKL 549 >ref|XP_006840897.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda] gi|548842752|gb|ERN02572.1| hypothetical protein AMTR_s00087p00078190 [Amborella trichopoda] Length = 592 Score = 118 bits (296), Expect = 8e-25 Identities = 57/67 (85%), Positives = 62/67 (92%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI DLDLAE DIKKALEIDP+NRDVKLEY+TLKEK+KEYNKK+AKFY Sbjct: 493 NVKALYRRAQAYIHTADLDLAELDIKKALEIDPDNRDVKLEYRTLKEKLKEYNKKEAKFY 552 Query: 32 GNMFSKM 12 GNMFS+M Sbjct: 553 GNMFSRM 559 >ref|XP_004510236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cicer arietinum] Length = 577 Score = 118 bits (296), Expect = 8e-25 Identities = 61/75 (81%), Positives = 67/75 (89%) Frame = -3 Query: 236 LLRLQVTFNVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEY 57 +L L+ T +V ALYRRAQAYI+L DLDLAEFDIKKALEIDP+NRDVKLEYK LKEK+KE Sbjct: 479 VLELEST-SVKALYRRAQAYIQLADLDLAEFDIKKALEIDPDNRDVKLEYKVLKEKMKEI 537 Query: 56 NKKQAKFYGNMFSKM 12 NKK AKFYGNMFSKM Sbjct: 538 NKKDAKFYGNMFSKM 552 >ref|XP_003547780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Glycine max] Length = 574 Score = 118 bits (296), Expect = 8e-25 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRR QAYI+L DLDLAEFDIKKALE++PNNRDVKLEY TLKEK+KEYNKK+AKFY Sbjct: 483 NVKALYRRTQAYIQLADLDLAEFDIKKALELEPNNRDVKLEYVTLKEKMKEYNKKEAKFY 542 Query: 32 GNMFSKM 12 GNMF+K+ Sbjct: 543 GNMFNKL 549 >dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Length = 573 Score = 118 bits (296), Expect = 8e-25 Identities = 58/75 (77%), Positives = 67/75 (89%) Frame = -3 Query: 236 LLRLQVTFNVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEY 57 +L L+ T NV ALYRRAQAY+ + DLDLAEFDIKKALEIDPNNRDVKLEYK LK+K+KE+ Sbjct: 475 VLELEST-NVKALYRRAQAYMNMADLDLAEFDIKKALEIDPNNRDVKLEYKALKDKVKEF 533 Query: 56 NKKQAKFYGNMFSKM 12 NKK AKFYGNMF+K+ Sbjct: 534 NKKDAKFYGNMFAKL 548 >ref|XP_007049646.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao] gi|508701907|gb|EOX93803.1| Rotamase FKBP 1 isoform 1 [Theobroma cacao] Length = 573 Score = 118 bits (295), Expect = 1e-24 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = -3 Query: 212 NVLALYRRAQAYIELQDLDLAEFDIKKALEIDPNNRDVKLEYKTLKEKIKEYNKKQAKFY 33 NV ALYRRAQAYI L DLDLAEFDIKKALE+DP+NR+VKLEYK LKEK+KEYNKK++KFY Sbjct: 482 NVKALYRRAQAYIHLADLDLAEFDIKKALELDPDNREVKLEYKVLKEKMKEYNKKESKFY 541 Query: 32 GNMFSKM 12 GNMF+KM Sbjct: 542 GNMFAKM 548