BLASTX nr result
ID: Paeonia22_contig00009453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00009453 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 142 5e-32 ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Popu... 137 2e-30 ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prun... 135 5e-30 gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] 133 3e-29 ref|XP_007013756.1| Pentatricopeptide repeat (PPR) superfamily p... 132 4e-29 ref|XP_007013754.1| Pentatricopeptide repeat superfamily protein... 132 4e-29 ref|XP_007013753.1| Pentatricopeptide repeat superfamily protein... 132 4e-29 ref|XP_007161257.1| hypothetical protein PHAVU_001G055200g [Phas... 131 1e-28 ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containi... 125 6e-27 ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containi... 125 6e-27 ref|XP_004498635.1| PREDICTED: pentatricopeptide repeat-containi... 125 8e-27 ref|XP_006476197.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 124 1e-26 ref|XP_006450554.1| hypothetical protein CICLE_v10008018mg [Citr... 124 1e-26 ref|XP_003588687.1| Pentatricopeptide repeat-containing protein ... 124 1e-26 ref|XP_006399632.1| hypothetical protein EUTSA_v10013015mg [Eutr... 124 2e-26 ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containi... 122 7e-26 ref|XP_002516618.1| pentatricopeptide repeat-containing protein,... 120 2e-25 gb|EYU21917.1| hypothetical protein MIMGU_mgv1a017906mg [Mimulus... 119 3e-25 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containi... 119 4e-25 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 142 bits (358), Expect = 5e-32 Identities = 63/89 (70%), Positives = 82/89 (92%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A+++ IRD DSE++LF++LLDSLCKEGHV+VAS+Y ++++ L+PSWVPSIRVYN+LLNG Sbjct: 201 AFSLDSIRDRDSEWSLFKILLDSLCKEGHVRVASEYFDQQRGLDPSWVPSIRVYNVLLNG 260 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK+AE+LW MK+ENVKP+VVTY Sbjct: 261 WFRSRKLKRAEQLWRTMKRENVKPTVVTY 289 >ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] gi|222854612|gb|EEE92159.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] Length = 607 Score = 137 bits (344), Expect = 2e-30 Identities = 62/89 (69%), Positives = 78/89 (87%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A ++ I +S++ +LF++LLDSLCKEGHV+VA+DY +RK E +P WVPS+R+YNILLNG Sbjct: 211 ASSLDLIHNSEAGTSLFEILLDSLCKEGHVRVATDYFDRKVEKDPCWVPSVRIYNILLNG 270 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK AERLW+EMKK+NVKPSVVTY Sbjct: 271 WFRSRKLKHAERLWLEMKKKNVKPSVVTY 299 >ref|XP_007222034.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] gi|462418970|gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 135 bits (341), Expect = 5e-30 Identities = 62/89 (69%), Positives = 77/89 (86%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N+ +S+SE +LF+VLLDSLCKEG V+VAS+Y + K++L P W+PS+RVYNILLNG Sbjct: 213 ASNLDSFLNSESEMSLFEVLLDSLCKEGLVRVASEYFDMKRKLHPDWIPSVRVYNILLNG 272 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK+AERLW EMK++NVKPSVVTY Sbjct: 273 WFRSRKLKRAERLWAEMKRDNVKPSVVTY 301 >gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] Length = 612 Score = 133 bits (334), Expect = 3e-29 Identities = 62/89 (69%), Positives = 74/89 (83%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N PI SE +LF +LLD+LCKEGHV+ ASDY KK+L+PSW+PSIR YNILLNG Sbjct: 219 ASNSVPICSYISEISLFGILLDALCKEGHVRAASDYFNEKKKLDPSWIPSIRAYNILLNG 278 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK+AERLWMEMK++NV+ +VVTY Sbjct: 279 WFRSRKLKRAERLWMEMKRDNVRSTVVTY 307 >ref|XP_007013756.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|590579336|ref|XP_007013758.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784119|gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784121|gb|EOY31377.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 560 Score = 132 bits (333), Expect = 4e-29 Identities = 61/89 (68%), Positives = 74/89 (83%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A ++ I +SD E NLF+++LDSLCKEGHV+V S+Y RK+E + WVPSI+VYNILLNG Sbjct: 160 AKSLEQICNSDEETNLFEIMLDSLCKEGHVRVVSEYLTRKRETDLGWVPSIKVYNILLNG 219 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK AERLW++MKKE V PSVVTY Sbjct: 220 WFRSRKLKHAERLWLDMKKEGVLPSVVTY 248 >ref|XP_007013754.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] gi|508784117|gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] Length = 584 Score = 132 bits (333), Expect = 4e-29 Identities = 61/89 (68%), Positives = 74/89 (83%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A ++ I +SD E NLF+++LDSLCKEGHV+V S+Y RK+E + WVPSI+VYNILLNG Sbjct: 184 AKSLEQICNSDEETNLFEIMLDSLCKEGHVRVVSEYLTRKRETDLGWVPSIKVYNILLNG 243 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK AERLW++MKKE V PSVVTY Sbjct: 244 WFRSRKLKHAERLWLDMKKEGVLPSVVTY 272 >ref|XP_007013753.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590579326|ref|XP_007013755.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590579333|ref|XP_007013757.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784116|gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784118|gb|EOY31374.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784120|gb|EOY31376.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 595 Score = 132 bits (333), Expect = 4e-29 Identities = 61/89 (68%), Positives = 74/89 (83%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A ++ I +SD E NLF+++LDSLCKEGHV+V S+Y RK+E + WVPSI+VYNILLNG Sbjct: 195 AKSLEQICNSDEETNLFEIMLDSLCKEGHVRVVSEYLTRKRETDLGWVPSIKVYNILLNG 254 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK AERLW++MKKE V PSVVTY Sbjct: 255 WFRSRKLKHAERLWLDMKKEGVLPSVVTY 283 >ref|XP_007161257.1| hypothetical protein PHAVU_001G055200g [Phaseolus vulgaris] gi|561034721|gb|ESW33251.1| hypothetical protein PHAVU_001G055200g [Phaseolus vulgaris] Length = 606 Score = 131 bits (329), Expect = 1e-28 Identities = 64/89 (71%), Positives = 74/89 (83%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N I DS SE +LF++L+DSLCKEG V+ AS+Y +KEL+ SWVPSIRVYNI+LNG Sbjct: 214 ARNNKSIVDSGSEMSLFEILMDSLCKEGSVREASEYFLWRKELDLSWVPSIRVYNIMLNG 273 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLKQ ERLW EMKKENV+PSVVTY Sbjct: 274 WFRSRKLKQGERLWEEMKKENVRPSVVTY 302 >ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 582 Score = 125 bits (314), Expect = 6e-27 Identities = 57/89 (64%), Positives = 73/89 (82%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N+ S+SE +LF++LLDSLCKEG V+VA++Y + K++ W+PS+RVYNILLNG Sbjct: 186 ATNLDSFLSSESEMSLFEILLDSLCKEGLVRVATEYFDGKRKSHRDWIPSVRVYNILLNG 245 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK+AERLW+EMK + VKPSVVTY Sbjct: 246 WFRSRKLKKAERLWVEMKSDGVKPSVVTY 274 >ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum lycopersicum] Length = 602 Score = 125 bits (314), Expect = 6e-27 Identities = 58/77 (75%), Positives = 67/77 (87%) Frame = -1 Query: 231 EFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNGWFRSRKLKQAER 52 E NLF++LLDSLCKEGH++ ASDY R+K + +W PSIRVYNILLNGWFRSRKLK+AER Sbjct: 220 EDNLFEILLDSLCKEGHIREASDYFYRRKGKDLNWSPSIRVYNILLNGWFRSRKLKKAER 279 Query: 51 LWMEMKKENVKPSVVTY 1 LW EMKKE +KPSVVTY Sbjct: 280 LWTEMKKEGIKPSVVTY 296 >ref|XP_004498635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cicer arietinum] Length = 596 Score = 125 bits (313), Expect = 8e-27 Identities = 60/83 (72%), Positives = 69/83 (83%) Frame = -1 Query: 249 IRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNGWFRSRK 70 I DS SE +LF +L+DSLCKEG V+ AS+Y R+KE + WVPS RVYNI+LNGWFR+RK Sbjct: 209 IVDSMSEMSLFGILIDSLCKEGSVREASEYFLRRKETDLGWVPSTRVYNIMLNGWFRARK 268 Query: 69 LKQAERLWMEMKKENVKPSVVTY 1 LK AERLW EMKKENVKPSVVTY Sbjct: 269 LKHAERLWEEMKKENVKPSVVTY 291 >ref|XP_006476197.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Citrus sinensis] Length = 551 Score = 124 bits (312), Expect = 1e-26 Identities = 54/89 (60%), Positives = 73/89 (82%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N+ +++ DS +LF++LLDSLCK+G VK AS+Y ++KEL+ SW P++RVYNILLNG Sbjct: 180 ANNLDMVKNFDSGASLFEILLDSLCKQGRVKAASEYFHKRKELDQSWAPTVRVYNILLNG 239 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRS+ +K AER W+EM+KENV P+VVTY Sbjct: 240 WFRSKNVKDAERFWLEMRKENVTPNVVTY 268 >ref|XP_006450554.1| hypothetical protein CICLE_v10008018mg [Citrus clementina] gi|557553780|gb|ESR63794.1| hypothetical protein CICLE_v10008018mg [Citrus clementina] Length = 517 Score = 124 bits (312), Expect = 1e-26 Identities = 54/89 (60%), Positives = 73/89 (82%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N+ +++ DS +LF++LLDSLCK+G VK AS+Y ++KEL+ SW P++RVYNILLNG Sbjct: 180 ANNLDMVKNFDSGASLFEILLDSLCKQGRVKAASEYFHKRKELDQSWAPTVRVYNILLNG 239 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRS+ +K AER W+EM+KENV P+VVTY Sbjct: 240 WFRSKNVKDAERFWLEMRKENVTPNVVTY 268 >ref|XP_003588687.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477735|gb|AES58938.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 587 Score = 124 bits (311), Expect = 1e-26 Identities = 58/83 (69%), Positives = 69/83 (83%) Frame = -1 Query: 249 IRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNGWFRSRK 70 I DS SE +LF++L+DSLCKEG + AS+Y R+KE + WVPSIRVYNI+LNGWFR+RK Sbjct: 210 IVDSVSEMSLFEILIDSLCKEGSAREASEYLLRRKETDLGWVPSIRVYNIMLNGWFRARK 269 Query: 69 LKQAERLWMEMKKENVKPSVVTY 1 LK AERLW EMK ENV+PSVVTY Sbjct: 270 LKHAERLWEEMKNENVRPSVVTY 292 >ref|XP_006399632.1| hypothetical protein EUTSA_v10013015mg [Eutrema salsugineum] gi|557100722|gb|ESQ41085.1| hypothetical protein EUTSA_v10013015mg [Eutrema salsugineum] Length = 603 Score = 124 bits (310), Expect = 2e-26 Identities = 57/89 (64%), Positives = 71/89 (79%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A + P+ S SE L +VLLD+LCKEGHV+ AS Y ER++ ++ +WVPS+R++NILLNG Sbjct: 201 ARSYDPVCKSASELKLLEVLLDALCKEGHVREASMYLERRRRIDSNWVPSVRIFNILLNG 260 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLKQAE LW EMK NVKP+VVTY Sbjct: 261 WFRSRKLKQAENLWAEMKVMNVKPTVVTY 289 >ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum tuberosum] Length = 604 Score = 122 bits (305), Expect = 7e-26 Identities = 57/77 (74%), Positives = 66/77 (85%) Frame = -1 Query: 231 EFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNGWFRSRKLKQAER 52 E NLF++LLDSLCKEG ++ ASDY R+K + +W PSIRVYNILLNGWFRSRKLK+AER Sbjct: 220 EDNLFEILLDSLCKEGLIREASDYFYRRKGQDSNWSPSIRVYNILLNGWFRSRKLKKAER 279 Query: 51 LWMEMKKENVKPSVVTY 1 LW EMKKE +KPSVVTY Sbjct: 280 LWTEMKKEGIKPSVVTY 296 >ref|XP_002516618.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544438|gb|EEF45959.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 577 Score = 120 bits (302), Expect = 2e-25 Identities = 51/74 (68%), Positives = 64/74 (86%) Frame = -1 Query: 222 LFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNGWFRSRKLKQAERLWM 43 L ++LLDSLCKEGHV+VA +Y + +K+L+ W+P +R+YNI+LNGWFRSRKLK AERLW+ Sbjct: 195 LLEILLDSLCKEGHVRVAKEYFDSRKQLDSCWIPHVRIYNIMLNGWFRSRKLKHAERLWL 254 Query: 42 EMKKENVKPSVVTY 1 EMKK NV PSVVTY Sbjct: 255 EMKKNNVSPSVVTY 268 >gb|EYU21917.1| hypothetical protein MIMGU_mgv1a017906mg [Mimulus guttatus] Length = 581 Score = 119 bits (299), Expect = 3e-25 Identities = 57/81 (70%), Positives = 62/81 (76%) Frame = -1 Query: 243 DSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNGWFRSRKLK 64 D D+E NLF LLDSLCKEGHV AS YCE +K +PSW P IRVYNILLNG+ RSRKLK Sbjct: 200 DPDTENNLFDKLLDSLCKEGHVSTASQYCENRKTKDPSWAPPIRVYNILLNGYLRSRKLK 259 Query: 63 QAERLWMEMKKENVKPSVVTY 1 A RLW MKKE VK +VVTY Sbjct: 260 HAMRLWESMKKEKVKANVVTY 280 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] gi|449503560|ref|XP_004162063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] Length = 615 Score = 119 bits (299), Expect = 3e-25 Identities = 57/89 (64%), Positives = 70/89 (78%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N+ I + SE LF++LLDSLCKEGHV+VAS+Y RK+E+ S+ PSIR YNIL+NG Sbjct: 218 ACNLETISGTGSE-GLFEILLDSLCKEGHVRVASEYFNRKREMGSSFEPSIRAYNILING 276 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFRSRKLK A+RLW EMKK + P+VVTY Sbjct: 277 WFRSRKLKHAQRLWFEMKKNKISPTVVTY 305 >ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like isoform X1 [Glycine max] Length = 622 Score = 119 bits (298), Expect = 4e-25 Identities = 60/89 (67%), Positives = 71/89 (79%) Frame = -1 Query: 267 AYNIHPIRDSDSEFNLFQVLLDSLCKEGHVKVASDYCERKKELEPSWVPSIRVYNILLNG 88 A N I DS SE +L ++L+DSLCKEG V+ AS+Y KKEL+ SWVPSIRVYNI+LNG Sbjct: 227 ATNNKSIVDSGSEMSLLEILMDSLCKEGSVREASEYFLWKKELDLSWVPSIRVYNIMLNG 286 Query: 87 WFRSRKLKQAERLWMEMKKENVKPSVVTY 1 WFR RKLKQ ERLW EM KEN++P+VVTY Sbjct: 287 WFRLRKLKQGERLWAEM-KENMRPTVVTY 314