BLASTX nr result
ID: Paeonia22_contig00009194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00009194 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30815.3| unnamed protein product [Vitis vinifera] 127 2e-27 ref|XP_007025185.1| Tetratricopeptide repeat-like superfamily pr... 115 5e-24 ref|XP_006467538.1| PREDICTED: uncharacterized protein LOC102607... 115 8e-24 ref|XP_006467537.1| PREDICTED: uncharacterized protein LOC102607... 115 8e-24 ref|XP_006467536.1| PREDICTED: uncharacterized protein LOC102607... 115 8e-24 ref|XP_006449620.1| hypothetical protein CICLE_v10014087mg [Citr... 115 8e-24 ref|XP_006449619.1| hypothetical protein CICLE_v10014087mg [Citr... 115 8e-24 ref|XP_004504242.1| PREDICTED: uncharacterized protein LOC101508... 115 8e-24 ref|XP_004170847.1| PREDICTED: pre-mRNA-processing factor 39-lik... 115 8e-24 ref|XP_004147431.1| PREDICTED: pre-mRNA-processing factor 39-lik... 115 8e-24 gb|EXB86585.1| Pre-mRNA-processing factor 39 [Morus notabilis] 110 2e-22 ref|XP_002519747.1| Pre-mRNA-processing protein prp39, putative ... 109 3e-22 ref|XP_004295421.1| PREDICTED: uncharacterized protein LOC101301... 104 1e-20 ref|XP_007159522.1| hypothetical protein PHAVU_002G244600g [Phas... 103 3e-20 ref|XP_002865195.1| binding protein [Arabidopsis lyrata subsp. l... 102 7e-20 ref|NP_199452.2| pre-mRNA-processing factor 39 [Arabidopsis tha... 101 1e-19 dbj|BAB11095.1| unnamed protein product [Arabidopsis thaliana] 101 1e-19 ref|XP_006398334.1| hypothetical protein EUTSA_v10000754mg [Eutr... 100 3e-19 ref|XP_006355594.1| PREDICTED: uncharacterized protein LOC102590... 98 1e-18 ref|XP_006279931.1| hypothetical protein CARUB_v10025790mg, part... 98 1e-18 >emb|CBI30815.3| unnamed protein product [Vitis vinifera] Length = 1195 Score = 127 bits (318), Expect = 2e-27 Identities = 59/84 (70%), Positives = 68/84 (80%) Frame = +1 Query: 61 MEKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLC 240 ME + V D KL EF++KG L FDAWTSLIS IE+ YP+D +KICLVYDSFLSEFPLC Sbjct: 1 MEDDCSVDFDVLKLPEFVAKGLLGFDAWTSLISNIEKTYPDDIKKICLVYDSFLSEFPLC 60 Query: 241 HVYWRKYADHTARLCTVDKVIGVF 312 + YWRKYADH +RLCTVDKVI V+ Sbjct: 61 YGYWRKYADHKSRLCTVDKVIEVY 84 >ref|XP_007025185.1| Tetratricopeptide repeat-like superfamily protein, PRP39-2,PRP39-2, putative [Theobroma cacao] gi|508780551|gb|EOY27807.1| Tetratricopeptide repeat-like superfamily protein, PRP39-2,PRP39-2, putative [Theobroma cacao] Length = 1166 Score = 115 bits (289), Expect = 5e-24 Identities = 50/78 (64%), Positives = 62/78 (79%) Frame = +1 Query: 79 VGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRK 258 +G D KL EFI++G LDFD WTSLI ++E ++ ++ EKICLVYDSFL EFPLC+ YWRK Sbjct: 20 LGFDEVKLKEFIAQGKLDFDGWTSLILDVENSFHDEIEKICLVYDSFLFEFPLCYGYWRK 79 Query: 259 YADHTARLCTVDKVIGVF 312 YADH RLCT+DK + VF Sbjct: 80 YADHVIRLCTIDKAVEVF 97 >ref|XP_006467538.1| PREDICTED: uncharacterized protein LOC102607594 isoform X3 [Citrus sinensis] Length = 1064 Score = 115 bits (287), Expect = 8e-24 Identities = 55/83 (66%), Positives = 64/83 (77%) Frame = +1 Query: 64 EKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCH 243 E VG L EFI++GSLDFD WTSLISEIE + P+D E I LVYDSFL+EFPLC+ Sbjct: 14 EPNSPVGFGKQGLEEFIAEGSLDFDEWTSLISEIENSCPDDIEMIGLVYDSFLAEFPLCY 73 Query: 244 VYWRKYADHTARLCTVDKVIGVF 312 YWRKYADH ARLC++DKV+ VF Sbjct: 74 GYWRKYADHKARLCSIDKVVEVF 96 >ref|XP_006467537.1| PREDICTED: uncharacterized protein LOC102607594 isoform X2 [Citrus sinensis] Length = 1090 Score = 115 bits (287), Expect = 8e-24 Identities = 55/83 (66%), Positives = 64/83 (77%) Frame = +1 Query: 64 EKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCH 243 E VG L EFI++GSLDFD WTSLISEIE + P+D E I LVYDSFL+EFPLC+ Sbjct: 14 EPNSPVGFGKQGLEEFIAEGSLDFDEWTSLISEIENSCPDDIEMIGLVYDSFLAEFPLCY 73 Query: 244 VYWRKYADHTARLCTVDKVIGVF 312 YWRKYADH ARLC++DKV+ VF Sbjct: 74 GYWRKYADHKARLCSIDKVVEVF 96 >ref|XP_006467536.1| PREDICTED: uncharacterized protein LOC102607594 isoform X1 [Citrus sinensis] Length = 1091 Score = 115 bits (287), Expect = 8e-24 Identities = 55/83 (66%), Positives = 64/83 (77%) Frame = +1 Query: 64 EKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCH 243 E VG L EFI++GSLDFD WTSLISEIE + P+D E I LVYDSFL+EFPLC+ Sbjct: 14 EPNSPVGFGKQGLEEFIAEGSLDFDEWTSLISEIENSCPDDIEMIGLVYDSFLAEFPLCY 73 Query: 244 VYWRKYADHTARLCTVDKVIGVF 312 YWRKYADH ARLC++DKV+ VF Sbjct: 74 GYWRKYADHKARLCSIDKVVEVF 96 >ref|XP_006449620.1| hypothetical protein CICLE_v10014087mg [Citrus clementina] gi|557552231|gb|ESR62860.1| hypothetical protein CICLE_v10014087mg [Citrus clementina] Length = 1128 Score = 115 bits (287), Expect = 8e-24 Identities = 55/83 (66%), Positives = 64/83 (77%) Frame = +1 Query: 64 EKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCH 243 E VG L EFI++GSLDFD WTSLISEIE + P+D E I LVYDSFL+EFPLC+ Sbjct: 70 EPNSPVGFGKQGLEEFIAEGSLDFDEWTSLISEIENSCPDDIEMIGLVYDSFLAEFPLCY 129 Query: 244 VYWRKYADHTARLCTVDKVIGVF 312 YWRKYADH ARLC++DKV+ VF Sbjct: 130 GYWRKYADHKARLCSIDKVVEVF 152 >ref|XP_006449619.1| hypothetical protein CICLE_v10014087mg [Citrus clementina] gi|557552230|gb|ESR62859.1| hypothetical protein CICLE_v10014087mg [Citrus clementina] Length = 1159 Score = 115 bits (287), Expect = 8e-24 Identities = 55/83 (66%), Positives = 64/83 (77%) Frame = +1 Query: 64 EKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCH 243 E VG L EFI++GSLDFD WTSLISEIE + P+D E I LVYDSFL+EFPLC+ Sbjct: 70 EPNSPVGFGKQGLEEFIAEGSLDFDEWTSLISEIENSCPDDIEMIGLVYDSFLAEFPLCY 129 Query: 244 VYWRKYADHTARLCTVDKVIGVF 312 YWRKYADH ARLC++DKV+ VF Sbjct: 130 GYWRKYADHKARLCSIDKVVEVF 152 >ref|XP_004504242.1| PREDICTED: uncharacterized protein LOC101508685 [Cicer arietinum] Length = 1074 Score = 115 bits (287), Expect = 8e-24 Identities = 52/75 (69%), Positives = 60/75 (80%) Frame = +1 Query: 88 DGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYAD 267 D +L E ISKGSLDFD W +LISEIE+ YP + EKICLVY+ FLSEFPLCH YWRKYA Sbjct: 14 DNLELEEVISKGSLDFDEWVTLISEIEKVYPVNVEKICLVYNHFLSEFPLCHGYWRKYAA 73 Query: 268 HTARLCTVDKVIGVF 312 H +LCT+DKV+ VF Sbjct: 74 HVTQLCTMDKVVEVF 88 >ref|XP_004170847.1| PREDICTED: pre-mRNA-processing factor 39-like [Cucumis sativus] Length = 421 Score = 115 bits (287), Expect = 8e-24 Identities = 54/84 (64%), Positives = 63/84 (75%) Frame = +1 Query: 61 MEKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLC 240 +E + VG+D KL E + K LDF+ WTSLISEIE YP+ EKI LVYDSFLSEFPLC Sbjct: 18 IESDSAVGLDESKLYEVVPKCGLDFEEWTSLISEIERKYPDVIEKISLVYDSFLSEFPLC 77 Query: 241 HVYWRKYADHTARLCTVDKVIGVF 312 H YWRKYA H RLC+VD+V+ VF Sbjct: 78 HGYWRKYASHKTRLCSVDRVVDVF 101 >ref|XP_004147431.1| PREDICTED: pre-mRNA-processing factor 39-like [Cucumis sativus] Length = 901 Score = 115 bits (287), Expect = 8e-24 Identities = 54/84 (64%), Positives = 63/84 (75%) Frame = +1 Query: 61 MEKEFQVGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLC 240 +E + VG+D KL E + K LDF+ WTSLISEIE YP+ EKI LVYDSFLSEFPLC Sbjct: 18 IESDSAVGLDESKLYEVVPKCGLDFEEWTSLISEIERKYPDVIEKISLVYDSFLSEFPLC 77 Query: 241 HVYWRKYADHTARLCTVDKVIGVF 312 H YWRKYA H RLC+VD+V+ VF Sbjct: 78 HGYWRKYASHKTRLCSVDRVVDVF 101 >gb|EXB86585.1| Pre-mRNA-processing factor 39 [Morus notabilis] Length = 418 Score = 110 bits (275), Expect = 2e-22 Identities = 51/77 (66%), Positives = 57/77 (74%) Frame = +1 Query: 82 GIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKY 261 G D KLNE + KGSL D W SLIS IE P++ EKI LVYDSFLSEFPLCH YWR+Y Sbjct: 21 GFDELKLNELVGKGSLGLDEWVSLISRIERTCPDNVEKIRLVYDSFLSEFPLCHGYWRRY 80 Query: 262 ADHTARLCTVDKVIGVF 312 ADH RLC VD+V+ VF Sbjct: 81 ADHKMRLCAVDEVVEVF 97 >ref|XP_002519747.1| Pre-mRNA-processing protein prp39, putative [Ricinus communis] gi|223541164|gb|EEF42720.1| Pre-mRNA-processing protein prp39, putative [Ricinus communis] Length = 395 Score = 109 bits (273), Expect = 3e-22 Identities = 51/78 (65%), Positives = 62/78 (79%) Frame = +1 Query: 79 VGIDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRK 258 V I+ KLNE I+ GSL+FD WTSLISE+E++YP+ E I LVYDSFLSEFPLC+ YWRK Sbjct: 14 VVINKAKLNEIIANGSLEFDEWTSLISEVEKSYPDSIEDIRLVYDSFLSEFPLCYGYWRK 73 Query: 259 YADHTARLCTVDKVIGVF 312 Y +H RL T+DKV+ VF Sbjct: 74 YVNHNIRLSTIDKVVQVF 91 >ref|XP_004295421.1| PREDICTED: uncharacterized protein LOC101301473 [Fragaria vesca subsp. vesca] Length = 1183 Score = 104 bits (259), Expect = 1e-20 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = +1 Query: 112 ISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYADHTARLCTV 291 I + S DFD WTSLIS+IE + P+D EK+C VYDSFL+EFPLCH YWR+YADH RLC++ Sbjct: 18 IRRASPDFDHWTSLISQIENSSPDDIEKLCSVYDSFLAEFPLCHGYWRRYADHKMRLCSI 77 Query: 292 DKVIGVF 312 DKV+ VF Sbjct: 78 DKVVEVF 84 >ref|XP_007159522.1| hypothetical protein PHAVU_002G244600g [Phaseolus vulgaris] gi|561032937|gb|ESW31516.1| hypothetical protein PHAVU_002G244600g [Phaseolus vulgaris] Length = 1083 Score = 103 bits (256), Expect = 3e-20 Identities = 47/75 (62%), Positives = 56/75 (74%) Frame = +1 Query: 88 DGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYAD 267 D L E ISKG FD WT LISE+E+ +P+D EKICLVY++FLSEFPLCH YWRKYA Sbjct: 11 DNLDLQEVISKGLSGFDEWTLLISEVEKLFPDDVEKICLVYNNFLSEFPLCHGYWRKYAA 70 Query: 268 HTARLCTVDKVIGVF 312 H + + T DKV+ VF Sbjct: 71 HMSCISTTDKVVEVF 85 >ref|XP_002865195.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297311030|gb|EFH41454.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 1035 Score = 102 bits (253), Expect = 7e-20 Identities = 45/76 (59%), Positives = 56/76 (73%) Frame = +1 Query: 85 IDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYA 264 +D +L E S G+LDFD W LISEIE ++P+D EK+CLVYD+FL EFPLCH YWRKYA Sbjct: 29 LDNDRLQETFSSGALDFDEWILLISEIETSFPDDIEKLCLVYDAFLLEFPLCHGYWRKYA 88 Query: 265 DHTARLCTVDKVIGVF 312 H +LCT + + VF Sbjct: 89 YHKIKLCTSEDALEVF 104 >ref|NP_199452.2| pre-mRNA-processing factor 39 [Arabidopsis thaliana] gi|332007996|gb|AED95379.1| pre-mRNA-processing factor 39 [Arabidopsis thaliana] Length = 1036 Score = 101 bits (251), Expect = 1e-19 Identities = 46/77 (59%), Positives = 58/77 (75%), Gaps = 1/77 (1%) Frame = +1 Query: 85 IDGFKLNEFISKGSLDFDAWTSLISEIEE-AYPEDREKICLVYDSFLSEFPLCHVYWRKY 261 +D +L E S G+LDFD WT LISEIE ++P+D EK+CLVYD+FL EFPLCH YWRKY Sbjct: 29 LDNDRLKETFSSGALDFDEWTLLISEIETTSFPDDIEKLCLVYDAFLLEFPLCHGYWRKY 88 Query: 262 ADHTARLCTVDKVIGVF 312 A H +LCT++ + VF Sbjct: 89 AYHKIKLCTLEDAVEVF 105 >dbj|BAB11095.1| unnamed protein product [Arabidopsis thaliana] Length = 1022 Score = 101 bits (251), Expect = 1e-19 Identities = 46/77 (59%), Positives = 58/77 (75%), Gaps = 1/77 (1%) Frame = +1 Query: 85 IDGFKLNEFISKGSLDFDAWTSLISEIEE-AYPEDREKICLVYDSFLSEFPLCHVYWRKY 261 +D +L E S G+LDFD WT LISEIE ++P+D EK+CLVYD+FL EFPLCH YWRKY Sbjct: 29 LDNDRLKETFSSGALDFDEWTLLISEIETTSFPDDIEKLCLVYDAFLLEFPLCHGYWRKY 88 Query: 262 ADHTARLCTVDKVIGVF 312 A H +LCT++ + VF Sbjct: 89 AYHKIKLCTLEDAVEVF 105 >ref|XP_006398334.1| hypothetical protein EUTSA_v10000754mg [Eutrema salsugineum] gi|557099423|gb|ESQ39787.1| hypothetical protein EUTSA_v10000754mg [Eutrema salsugineum] Length = 1045 Score = 100 bits (248), Expect = 3e-19 Identities = 44/75 (58%), Positives = 54/75 (72%) Frame = +1 Query: 88 DGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYAD 267 D +L E S G L+FD WT LISEIE +P+D EK+CLVYD+FL EFPLCH YWRKY Sbjct: 30 DNDRLKETFSSGELEFDDWTLLISEIETLFPDDIEKLCLVYDAFLLEFPLCHGYWRKYVY 89 Query: 268 HTARLCTVDKVIGVF 312 H +LCT++ + VF Sbjct: 90 HKIQLCTLEDAVEVF 104 >ref|XP_006355594.1| PREDICTED: uncharacterized protein LOC102590021 [Solanum tuberosum] Length = 1264 Score = 98.2 bits (243), Expect = 1e-18 Identities = 41/72 (56%), Positives = 54/72 (75%) Frame = +1 Query: 97 KLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYADHTA 276 +L + IS GS D D+W SLISEIE+ YP+D ICL +DSFLS+FPLCH +W++YA H A Sbjct: 21 RLKDMISGGSEDLDSWNSLISEIEKTYPDDSNTICLAFDSFLSKFPLCHWHWKRYAYHEA 80 Query: 277 RLCTVDKVIGVF 312 RLC +K + +F Sbjct: 81 RLCNAEKAVEIF 92 >ref|XP_006279931.1| hypothetical protein CARUB_v10025790mg, partial [Capsella rubella] gi|482548635|gb|EOA12829.1| hypothetical protein CARUB_v10025790mg, partial [Capsella rubella] Length = 1046 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/76 (55%), Positives = 55/76 (72%) Frame = +1 Query: 85 IDGFKLNEFISKGSLDFDAWTSLISEIEEAYPEDREKICLVYDSFLSEFPLCHVYWRKYA 264 +D +L E G LDFD W LISEIE ++P++ EK+CLVYD+FL EFPLCH YWRKYA Sbjct: 39 LDNDRLQETFCSGELDFDEWLLLISEIETSFPDNVEKLCLVYDAFLLEFPLCHGYWRKYA 98 Query: 265 DHTARLCTVDKVIGVF 312 H +LC+++ + VF Sbjct: 99 YHKIKLCSLEDAVEVF 114