BLASTX nr result
ID: Paeonia22_contig00008862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00008862 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265615.1| PREDICTED: uncharacterized protein LOC100264... 74 2e-11 emb|CAN75675.1| hypothetical protein VITISV_013266 [Vitis vinifera] 74 2e-11 gb|EXB62668.1| hypothetical protein L484_023964 [Morus notabilis] 63 5e-08 ref|XP_004307198.1| PREDICTED: uncharacterized protein LOC101309... 62 8e-08 ref|XP_007010825.1| MATH and LRR domain-containing protein PFE05... 60 3e-07 ref|XP_007010824.1| MATH and LRR domain-containing protein PFE05... 60 3e-07 gb|ACU18276.1| unknown [Glycine max] 57 2e-06 ref|XP_007218070.1| hypothetical protein PRUPE_ppa006285mg [Prun... 55 8e-06 >ref|XP_002265615.1| PREDICTED: uncharacterized protein LOC100264272 [Vitis vinifera] Length = 413 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = -3 Query: 167 LMDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYFDAETK 3 +MD YFGN T +E VVPK+ +L D + SPD WLQWG +PSESFGS NKYF ET+ Sbjct: 3 IMDQYFGNGT-EEFVVPKDLELLDNVESPDIWLQWGINPSESFGSLNKYFIMETE 56 >emb|CAN75675.1| hypothetical protein VITISV_013266 [Vitis vinifera] Length = 558 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = -3 Query: 167 LMDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYFDAETK 3 +MD YFGN T +E VVPK+ +L D + SPD WLQWG +PSESFGS NKYF ET+ Sbjct: 3 IMDQYFGNGT-EEFVVPKDLELLDNVESPDIWLQWGINPSESFGSLNKYFIMETE 56 >gb|EXB62668.1| hypothetical protein L484_023964 [Morus notabilis] Length = 452 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -3 Query: 167 LMDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNK 24 LMDWY N D+L+VPK+ LSDRLPSPDSW +WG ES+ S NK Sbjct: 42 LMDWYSANGI-DDLIVPKDGGLSDRLPSPDSWSKWGVGVMESYPSHNK 88 >ref|XP_004307198.1| PREDICTED: uncharacterized protein LOC101309290 [Fragaria vesca subsp. vesca] Length = 411 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = -3 Query: 164 MDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYF 18 MDWYFGN D+LVVP + SDRLPSPDSW +WG S SE F S NK + Sbjct: 1 MDWYFGNGI-DDLVVPNDGG-SDRLPSPDSWSKWGISASECFQSPNKCY 47 >ref|XP_007010825.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 2 [Theobroma cacao] gi|508727738|gb|EOY19635.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 2 [Theobroma cacao] Length = 395 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -3 Query: 164 MDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYF 18 MDW FGN D LVVP +Q+L+DRLPSP+SW +WG +F S NK F Sbjct: 1 MDWCFGNGIED-LVVPMDQELADRLPSPESWSKWGYYAPGNFESSNKCF 48 >ref|XP_007010824.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 1 [Theobroma cacao] gi|508727737|gb|EOY19634.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 1 [Theobroma cacao] Length = 535 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -3 Query: 164 MDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYF 18 MDW FGN D LVVP +Q+L+DRLPSP+SW +WG +F S NK F Sbjct: 34 MDWCFGNGIED-LVVPMDQELADRLPSPESWSKWGYYAPGNFESSNKCF 81 >gb|ACU18276.1| unknown [Glycine max] Length = 109 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 30/49 (61%) Frame = -3 Query: 164 MDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYF 18 MDWY+GN D LV P++QDL DR PSPD W WG +E F S F Sbjct: 1 MDWYYGNGINDYLV-PRDQDLLDRHPSPDYWSNWGIGATEGFNSPKNLF 48 >ref|XP_007218070.1| hypothetical protein PRUPE_ppa006285mg [Prunus persica] gi|462414532|gb|EMJ19269.1| hypothetical protein PRUPE_ppa006285mg [Prunus persica] Length = 419 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -3 Query: 164 MDWYFGNATADELVVPKEQDLSDRLPSPDSWLQWGRSPSESFGSQNKYF 18 M+WY+G+ D++VVP + SDRLPSPDSW +WG S SE F NK F Sbjct: 1 MEWYYGSGM-DDVVVPNDGG-SDRLPSPDSWSKWGISASECFQPTNKCF 47