BLASTX nr result
ID: Paeonia22_contig00008719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00008719 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293358.1| PREDICTED: acyl-CoA--sterol O-acyltransferas... 60 3e-07 ref|XP_007026258.1| Acyl-CoA sterol acyl transferase 1, putative... 57 2e-06 ref|XP_006438928.1| hypothetical protein CICLE_v10031885mg [Citr... 57 3e-06 ref|XP_007213866.1| hypothetical protein PRUPE_ppa018212mg [Prun... 57 3e-06 ref|XP_002527948.1| hypothetical protein RCOM_1184880 [Ricinus c... 55 1e-05 >ref|XP_004293358.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Fragaria vesca subsp. vesca] Length = 359 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 168 MEGGEINNFVKVWLVVYLSLCYCYTVGKITAKGIPRLLTI 287 ME GE+ +F+KVWL V+LSLCYCY + K KGIPRLL I Sbjct: 3 MELGEMGSFIKVWLTVFLSLCYCYALPKFVPKGIPRLLCI 42 >ref|XP_007026258.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao] gi|508781624|gb|EOY28880.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao] Length = 376 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +3 Query: 168 MEGGEINNFVKVWLVVYLSLCYCYTVGKITAKGIPRLLTI 287 ME GE+NNF+K+WL V +SL YCY +GKI KG RLL + Sbjct: 1 MESGEMNNFMKIWLCVVISLSYCYAIGKIIPKGTARLLCL 40 >ref|XP_006438928.1| hypothetical protein CICLE_v10031885mg [Citrus clementina] gi|557541124|gb|ESR52168.1| hypothetical protein CICLE_v10031885mg [Citrus clementina] Length = 367 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = +3 Query: 177 GEINNFVKVWLVVYLSLCYCYTVGKITAKGIPRLLTI 287 GE+ NF+KVWL V +SLCYCY +GK+ +KGI RL+ + Sbjct: 3 GEMKNFIKVWLSVTISLCYCYAIGKMASKGIKRLICL 39 >ref|XP_007213866.1| hypothetical protein PRUPE_ppa018212mg [Prunus persica] gi|462409731|gb|EMJ15065.1| hypothetical protein PRUPE_ppa018212mg [Prunus persica] Length = 378 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 177 GEINNFVKVWLVVYLSLCYCYTVGKITAKGIPRLLTI 287 GEI NF+KVWL V+LSL YCY GK KG PRLL I Sbjct: 3 GEIGNFIKVWLSVFLSLFYCYAFGKFVPKGFPRLLLI 39 >ref|XP_002527948.1| hypothetical protein RCOM_1184880 [Ricinus communis] gi|223532652|gb|EEF34437.1| hypothetical protein RCOM_1184880 [Ricinus communis] Length = 254 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +3 Query: 177 GEINNFVKVWLVVYLSLCYCYTVGKITAKGIPRLLTI 287 GEI NF+ VW+ V++SLCYCY +GK +KG RLL I Sbjct: 3 GEIQNFIWVWITVFISLCYCYAIGKFISKGTKRLLFI 39